Our Cincinnati dealer serving the Hamilton, Fairfield, and Middletown areas offers new and used models at affordable prices.
http://www.jakesweeneychevrolet.com/
TODAY'S RATING
#526,885
Date Range
HIGHEST TRAFFIC ON
Monday
LOAD TIME
16x16
32x32
Jake Sweeney Automotive
33 Wes●●●●●●r Road
Cin●●●ati , OH, 45246
US
View this contact
Jake Sweeney Automotive
Jake Sweeney Automotive
33 Wes●●●●●●r Road
Cin●●●ati , OH, 45246
US
View this contact
Jake Sweeney Automotive
Jake Sweeney Automotive
33 Wes●●●●●●r Road
Cin●●●ati , OH, 45246
US
View this contact
BUY YOUR DOMAIN
21
YEARS
6
MONTHS
12
DAYS
NETWORK SOLUTIONS, LLC.
WHOIS : whois.networksolutions.com
REFERRED : http://networksolutions.com
PAGES IN
THIS WEBSITE
19
SSL
EXTERNAL LINKS
9
SITE IP
23.215.10.33
LOAD TIME
0 sec
SCORE
6.2
New and Used Cincinnati Chevrolet Dealer | Jake Sweeney Chevrolet | jakesweeneychevrolet.com Reviews
https://jakesweeneychevrolet.com
Our Cincinnati dealer serving the Hamilton, Fairfield, and Middletown areas offers new and used models at affordable prices.
jakesweeneychevrolet.com
New Chevy Specials In Cincinnati | New Chevy Incentives Near Hamilton
http://www.jakesweeneychevrolet.com/specials/new.htm
33 West Kemper Road. Budget Buys Under $9995. Used Car Super Store. After Hours Drop Off. Get Pre-Approved in Seconds. KBB Instant Cash Offer! About Jake Sweeney Automotive. Why Buy from Jake Sweeney? With this tool, you can search inventory at any time as you browse our site. Results will remain visible allowing you to click on individual vehicles and alternate between vehicle detail pages. Drag results to the GET YOUR EPRICE pane to quickly request information on vehicles of interest. New to our site?
Featured New Chevy Cincinnati | Chevy dealer serving West Chester OH
http://www.jakesweeneychevrolet.com/featured-vehicles/new.htm
33 West Kemper Road. Budget Buys Under $9995. Used Car Super Store. After Hours Drop Off. Get Pre-Approved in Seconds. KBB Instant Cash Offer! About Jake Sweeney Automotive. Why Buy from Jake Sweeney? With this tool, you can search inventory at any time as you browse our site. Results will remain visible allowing you to click on individual vehicles and alternate between vehicle detail pages. Drag results to the GET YOUR EPRICE pane to quickly request information on vehicles of interest. New to our site?
Why GM Certified Cincinnati Chevy Dealer near Fairfield | Used Cincinnati Chevy Dealer
http://www.jakesweeneychevrolet.com/why-gm-certified.htm
33 West Kemper Road. Budget Buys Under $9995. Used Car Super Store. After Hours Drop Off. Get Pre-Approved in Seconds. KBB Instant Cash Offer! About Jake Sweeney Automotive. Why Buy from Jake Sweeney? With this tool, you can search inventory at any time as you browse our site. Results will remain visible allowing you to click on individual vehicles and alternate between vehicle detail pages. Drag results to the GET YOUR EPRICE pane to quickly request information on vehicles of interest. Equipped Certifie...
Service Appointment Chevy Cincinnati |Chevy Service Department near Hamilton
http://www.jakesweeneychevrolet.com/service-appointment.htm
33 West Kemper Road. Budget Buys Under $9995. Used Car Super Store. After Hours Drop Off. Get Pre-Approved in Seconds. KBB Instant Cash Offer! About Jake Sweeney Automotive. Why Buy from Jake Sweeney? With this tool, you can search inventory at any time as you browse our site. Results will remain visible allowing you to click on individual vehicles and alternate between vehicle detail pages. Drag results to the GET YOUR EPRICE pane to quickly request information on vehicles of interest. New to our site?
New Chevrolet Models Cincinnati | New Silverado, Cruze, Malibu, and more
http://www.jakesweeneychevrolet.com/new-inventory/index.htm
33 West Kemper Road. Budget Buys Under $9995. Used Car Super Store. After Hours Drop Off. Get Pre-Approved in Seconds. KBB Instant Cash Offer! About Jake Sweeney Automotive. Why Buy from Jake Sweeney? With this tool, you can search inventory at any time as you browse our site. Results will remain visible allowing you to click on individual vehicles and alternate between vehicle detail pages. Drag results to the GET YOUR EPRICE pane to quickly request information on vehicles of interest. Year: Old to New.
TOTAL PAGES IN THIS WEBSITE
19
Jake Sweeney Alfa Romeo-FIAT | New & Used Car Dealer | Florence, KY
http://www.fiatusaofflorence.com/index.htm
New and Used Inventory. Financing and Trade-In Appraisal. FIAT 500 vs. Competition. Express Lane Oil Change Service. Our Studio About Us. Leave Us a Review! AS ICONIC AS ITS DESIGN. 2015 FIAT 500 Pop. Laser Blu (Bright Met. Blue). 2016 FIAT 500X Easy. Bianco Gelato (White Clear Coat). 2015 FIAT 500 Pop. Fill out our quick financing pre-approval form to get into your new vehicle even faster. Research all of our models and trims in our on line studio. Need to know where we are located? Featuring not only F...
Jake Sweeney Automotive | New Dodge, Jeep, Mazda, FIAT, Kia, Chevrolet, BMW, Chrysler, Ram, Alfa Romeo dealership in , OH
http://www.jakesweeney.com/index.htm
KBB Instant Cash Offer! KBB Instant Cash Offer! KBB Instant Cash Offer! KBB Instant Cash Offer! KBB Instant Cash Offer! KBB Instant Cash Offer! Search by Body Style. 4WD Touring w/RES and Navi. 4WD Crew Cab 140.5 Sport. 4WD Crew Cab 149 Laramie. 4WD Quad Cab 140.5 Laramie. 535i xDrive Gran Turismo. Crew Cab Big Horn. Crew Cab Longhorn Limited. Double 128 Auto 4WD. Double Cab LTZ Z71. Quad Cab SLT DRW Diesel. Van Extended Cargo Van. Van Extended Passenger Van. Van LWB Passenger Van. 10,000 – $19,999.
TOTAL LINKS TO THIS WEBSITE
9
Jake Sweeney Automotive | New Dodge, Jeep, Mazda, FIAT, Kia, Chevrolet, BMW, Chrysler, Ram, Alfa Romeo dealership in , OH
Search by Body Style. 4WD Crew Cab 140.5 Express. 4WD Crew Cab 140.5 Tradesman. 4WD Mega Cab 160.5 Laramie. 4WD Quad Cab 140.5 SLT. Auto 2.5X Premium. HB I4 CVT 1.8 SL. Van G3500 Extended Cargo Van. Van LWB Passenger Van. 10,000 – $19,999. 20,000 – $29,999. 30,000 – $39,999. 40,000 – $49,999. 50,000 – $59,999. 60,000 – $69,999. 70,000 – $79,999. 80,000 – $89,999. 90,000 – $99,999. 100,000 – $149,999. Jake Sweeney Alfa Romeo (5). Jake Sweeney BMW (288). Jake Sweeney Buy Here Pay Here (209). 4WD V6 EX-L (1).
The Jake Sweeney Advantage
Track your maintenance all in one place. Login to view your service records. Last 6 Digits of VIN Number:. Increase your value at trade-in. Document all your maintenance. Receive exclusive membership benefits. Schedule your next service appointment with Jake Sweeney Automotive by clicking here.
Registrant WHOIS contact information verification
You have reached a domain that is pending ICANN verification. As of January 1, 2014 the Internet Corporation for Assigned Names and Numbers (ICANN) will mandate that all ICANN accredited registrars begin verifying the Registrant WHOIS contact information for all new domain registrations and Registrant contact modifications. Why this domain has been suspended. Email address has not been verified. This is a new domain registration and the Registrant email address has not been verified. Wenn Sie Inhaber der...
Original BMW Parts | BMW of Cincinnati
Welcome to BMW of Cincinnati, a Jake Sweeney Company, your source for BMW parts online. 105 W Kemper Rd, Cincinnati, OH 45246. Tabbing past or clicking of this link will close the Cart widget. Welcome to BMW of Cincinnati Original Parts and Accessories Online Store. Shop Original BMW Parts. I3 60Ah Rex Parts. I3 94Ah Rex Parts. I3s 94Ah Rex Parts. 105 W Kemper Rd. Cincinnati, OH 45246. 5 stars on 11. I like how the Diagram show every detail about a vehicle components. Close VIN entry layer.
Jake Sweeney Body Shop
169 Northland Boulevard Cincinnati, OH 45246. Jake Sweeney Body Shop. Has moved to a brand new 30,000 square foot facility located just a block from Jake Sweeney Auto Mall in Tri-County. Our new location, 169 Northland Blvd. Features all new, state-of-the-art equipment and a highly experienced staff that will provide you with excellent customer service and quality workmanship. We will work with your insurance company, not for your insurance company, never sacrificing quality to save money at your expense.
New and Used Cincinnati Chevrolet Dealer | Jake Sweeney Chevrolet
33 West Kemper Road. Get Pre-Approved in Seconds. Budget Buys Under $9995. Get Pre-Approved in Seconds. Used Car Super Store. Buy Here Pay Here. After Hours Drop Off. Get Pre-Approved in Seconds. About Jake Sweeney Automotive. Jake Sweeney Buy Here Pay Here (209). Jake Sweeney Chevrolet (937). Truck Crew Cab (75). Truck Double Cab (53). Truck Extended Cab (15). Truck Quad Cab (2). Truck Regular Cab (17). Truck Super Cab (4). Truck SuperCrew Cab (1). Van Cargo Van (4). Van G3500 Extended Cargo Van (1).
Jake Sweeney Chevrolet in Cincinnati | Dayton Chevrolet | Tri County
Sales - Call for Sunday Appts. Sales - Call for Sunday Appts. Sales - Call for Sunday Appts. New Chevrolet Model Offers. New Chevrolet Camaro Offers. New Chevrolet Cruze Offers. New Chevrolet Equinox Offers. New Chevrolet Malibu Offers. New Chevrolet Silverado 1500 Offers. New Chevrolet Model Offers. Air Conditioning Service Coupons. Auto Detailing Service Coupons. Check Engine Service Coupons. Coolant Flush Service Coupons. Oil Change Service Coupons. Wiper Blade Service Coupons. 335i xDrive Gran Turismo.
jakesweeneychryslerjeepdodge.com
Jake Sweeney Chrysler Jeep Dodge RAM | New & Used Car Dealer | Cincinnati, OH
Jake Sweeney Chrysler Jeep Dodge Ram. New Cars: 85 W Kemper RD Cincinnati, OH 45246. Used Cars: 135 Northland Blvd. New and Used Inventory. Financing and Trade-In Appraisal. Kelley Blue Book Trade-In. BBOL Value Your Trade. Mopar Parts and Service. Parts and Accessories Catalog. Express Lane Oil Change Service. Join our social network. ProMaster 2500 Cab Chassis. ProMaster 2500 Window Van. ProMaster 3500 Cab Chassis. 2014 Dodge SRT Viper GTS Coupe. 2014 Dodge SRT Viper GTS Coupe. Come on by Jake Sweeney ...
jakesweeneychryslerpaymentmatch.com
Jake Sweeney Chrysler Sales Event
85 West Kemper Road, Cincinnati. How can we contact you? GET A BETTER PAYMENT. ON A NEWER VEHICLE. What is your current payment? Months remaining in your finance/lease? What vehicle are you interested in? Your privacy is of utmost importance to us. Read More. By providing your personal information, you consent to its use and disclosure in accordance with our Privacy Policy. Therefore, it is important that you read and understand our privacy policy prior to providing any personal information about yourself.
Jake Sweeney FIAT Blog |
Jake Sweeney FIAT Blog. Visit Our Main Site. Jake Sweeney FIAT Blog. Visit Our Main Site. Get Trade-In Value Towards a FIAT Car. When you’re looking for new FIAT cars near Lexington, KY, consider heading to Jake Sweeney FIAT. Our customers receive the…. March 22, 2018. Get Pet Friendly with the 2018 FIAT 500L. Jake Sweeney FIAT knows that many Lexington, KY FIAT owners take their pets with them when driving. After all, why…. March 9, 2018. 2018 FIAT 124 Spider at Chicago Auto Show. February 20, 2018.
Custom Page
The Page Cannot be displayed. The page you are looking for is currently unavailable. The Web site might be experiencing technical difficulties, or you may need to adjust your browser settings.
SOCIAL ENGAGEMENT