Sponsored Link:

Page Analysis

Sponsored Link:


299 ratings.498 user reviews.

Web page information

  1. Keywords hit in search results
    abstract activity address after algebra analysis analyze backlinks channel conductance console customize cystic dedekind detailed diagram discover domain domains encyclopedia enigine every factors fescvcklmanktrilvtskmehlkkadkililhegssyfygtfselqnlqpdfssklmg fibrosis following functional gating icann ideal information initiates integral intestinal irdomain loading montana named networkrdomain nonzero optimalisation ownership personal phenotype phosphorylation private proper protein provide public rdomainprivacy regulation regulator regulatory reports required rescues review richard rules search shortened state still trafficking transmembrane university visit website websites welcome which while whois wikipedia
  2. Search Engine Recommended Keywords
    LSI-R Domains, Free Short Domain, Short Domain Name, Free Domain Name Search Engine, DOMAI Android App, URL Registration Search, Rock Shox Domain R, RockShox Domain R Coil 160,
r-domain.net website analysis, backlinks, seo.
r-domain.net. We provide SEO (search enigine optimalisation), backlinks info and website info. We analyze websites and domains and provide detailed reports
R Domain Review - Montana State University
back to diagram cftr review page . r domain review . fescvcklmanktrilvtskmehlkkadkililhegssyfygtfselqnlqpdfssklmg ...
rDomainPrivacy.com - Home Page
Our goal is to keep your personal data & ownership information private while still following the ICANN rules to provide a public Whois for your domain name(s).
Regulation of CFTR Trafficking by Its R Domain
Abstract. Phosphorylation of the R domain is required for cystic fibrosis transmembrane conductance regulator (CFTR) channel gating, and cAMP/protein ...
irdomain.org ... irdomain.org
Dedekind domain - Wikipedia, the free encyclopedia
In abstract algebra, a Dedekind domain or Dedekind ring, named after Richard Dedekind, is an integral domain in which every nonzero proper ideal factors into a ...
Welcome to networkrdomain.net
Welcome to networkrdomain.net : Web Address: To customize this page visit your web console!
A functional R domain from cystic fibrosis transmembrane ...
Phosphorylation of the regulatory (R) domain initiates cystic fibrosis transmembrane conductance regulator (CFTR) Cl − channel activity. To discover how the ...
Cystic fibrosis transmembrane conductance regulator with a ...
Cystic fibrosis transmembrane conductance regulator with a shortened R domain rescues the intestinal phenotype of CFTR −/− mice
No Coupons found for this website.

500 characters left

Your Review: (5 out of 5)
refresh captcha

Server Information
IP Address:
Site Disclaimer:

All trademarks are the property of their respective owners. The facts, figures, reviews, records, stats, and other data presented on this page is for suggestion and information purposes only. PageGlimpse.com is not responsible for any incorrect or incomplete information. PageGlimpse.com does not take responsibility for any user-reviews of websites inside its resource and reserves the right to keep or remove those. It is highly recommended that you review all the data for accuracy.