Page Analysis
Related Links:
webapps.cityofchicago.org
City of Chicago
No description found
No description found
http://webapps.cityofchicago.org/
Daily Ad Revenue: ~n/a
Estimated Revenue: ~n/a
Links: 82
Speed: (0.421 seconds) 4% of sites are slower.
Online Since: Oct 20, 1997

Web page information
- TitleCity of Chicago
- Keywords hit in search results about among application apply areas assessment available avenue avondale based bookmarks
buildingbuilt businesscablecertificationchicago citizens cityofchicago communitycompliancecontact contract county departmentdepartmentsdistrictdiverseydomains edsweb electronicencyclopediaerror exemptions filingfinancehouse https illinoisinformationinitiativeskimballlandmark licenses logan means michigan millionmilwaukeeofficialofficials online opportunities parking payment permit please pleased process procurement programs provide providing questions ranked record regarding report returns revenue reviewreviewsrichardsonian romanesque searches seniorservicessimilarsimplifysitessoftware source square states straddling street –style system taxpayer taxweb tickets united violations webappswebsitewebtax welcomewikipediaworld xmarks - Search Engine Recommended KeywordsIris Need Account Number, City of Chicago PIN Number, City of Chicago Tax Web, City of Chicago Web Apps, City of Chicago Tax Payment,

DMOZ Directory Information

- Directory Title:City of Chicago
- Directory Description:No Description Found
- Keywords:Chicago
- Categories:No dmoz categories found.

Owned Domains:

Sub domains:
| % | Sub Domain: | % of PageViews | PageViews per User |
|---|---|---|---|
| 89.4% | egov.cityofchicago.org | 77.3% | 4.9 |
| 5.3% | webapps.cityofchicago.org | 9.5% | 10.0 |
| 5.3% | parkingtickets.cityofchicago.org | 7.6% | 8.0 |
| 10.6% | cityofchicago.org | 2.8% | 1.5 |
| 5.3% | home.cityofchicago.org | 1.9% | 2.0 |
| 5.3% | ci.chi.il.us | 0.9% | 1.0 |
City of Chicago :: Error Page
Most Used Online Services. Apply for Building E-Permit; Apply for Business Licenses; Apply for Job Opportunities; Look up Building Violations; Pay Parking Tickets
Welcome To WebTax. Welcome to the Chicago Department of Finance Electronic Tax Filing and Payment site. Our goal is to simplify the process of filing tax returns and ...
Welcome to the official City of Chicago Website. The source for information about City services, departments, programs and initiatives, and officials for Chicago ...
Review of Webapps.cityofchicago.org. Webapps.cityofchicago.org is ranked 42,050 in the world (among the 30 million domains), a low rank means that this website gets ...
City of Chicago - Department of Revenue - Web Tax [Report This] Bookmarks
Go on-line at https://webapps.cityofchicago.org/EDSWeb. If you have any questions regarding the on-line EDS application, please contact your Procurement Contract ...
Providing Cook County Taxpayer information and assessment record searches. Info for filing, exemptions, and Senior Citizens. Online tax form available.
The Milwaukee-Diversey-Kimball District is an official City of Chicago Landmark District straddling the Chicago community areas of Avondale and Logan Square at the ...
The Cable House is a Richardsonian Romanesque –style house near Michigan Avenue, at 25 East Erie Street, in Chicago, Illinois, United States. The house was built in ...
City of Chicago is pleased to provide its Certification and Compliance System. This web-based software system is accessible to City of Chicago Departments, Certified ...
Most Used Online Services. Apply for Building E-Permit; Apply for Business Licenses; Apply for Job Opportunities; Look up Building Violations; Pay Parking Tickets
http://webapps.cityofchicago.org/
City of Chicago - Department of Finance - Web TaxWelcome To WebTax. Welcome to the Chicago Department of Finance Electronic Tax Filing and Payment site. Our goal is to simplify the process of filing tax returns and ...
https://webapps.cityofchicago.org/TaxWeb/
City of ChicagoWelcome to the official City of Chicago Website. The source for information about City services, departments, programs and initiatives, and officials for Chicago ...
http://www.cityofchicago.org/city/en.html
www.Webapps.cityofchicago.org . Webapps.cityofchicago - City of ...Review of Webapps.cityofchicago.org. Webapps.cityofchicago.org is ranked 42,050 in the world (among the 30 million domains), a low rank means that this website gets ...
http://www.webstatsdomain.com/domains/webapps.cityofchicago.org/
webapps.cityofchicago.org/TaxWeb/ - Similar Sites and Reviews | XmarksCity of Chicago - Department of Revenue - Web Tax [Report This] Bookmarks
http://www.xmarks.com/site/webapps.cityofchicago.org/TaxWeb/
City of Chicago :: File Your EDS OnlineGo on-line at https://webapps.cityofchicago.org/EDSWeb. If you have any questions regarding the on-line EDS application, please contact your Procurement Contract ...
http://www.cityofchicago.org/city/en/depts/dps/provdrs/contract/news/2010/sep/file_your_eds_online.html
webapps.cityofchicago.org/lic/iris.jsp - Similar Sites and Reviews ...Providing Cook County Taxpayer information and assessment record searches. Info for filing, exemptions, and Senior Citizens. Online tax form available.
http://www.xmarks.com/site/webapps.cityofchicago.org/lic/iris.jsp
Milwaukee-Diversey-Kimball District - Wikipedia, the free encyclopediaThe Milwaukee-Diversey-Kimball District is an official City of Chicago Landmark District straddling the Chicago community areas of Avondale and Logan Square at the ...
http://en.wikipedia.org/wiki/Milwaukee-Diversey-Kimball_District
Cable House - Wikipedia, the free encyclopediaThe Cable House is a Richardsonian Romanesque –style house near Michigan Avenue, at 25 East Erie Street, in Chicago, Illinois, United States. The house was built in ...
http://en.wikipedia.org/wiki/Cable_House
City of Chicago - Certification and Compliance SystemCity of Chicago is pleased to provide its Certification and Compliance System. This web-based software system is accessible to City of Chicago Departments, Certified ...
https://chicago.mwdbe.com/
No Coupons found for this website.
| IP Address: | 0.0.0.0 |
| Location: | , , |
| Zip Code: | |
| Geo Location: | 0, 0 |
| Server: | |
| Powered By: | |
| ASP.net version: | |
| DNS Servers | |

WHOIS Information:
Domain Info:
- Domain was Created:
- Domain Expires:
- Domain was last Updated:
| Alexa Rank | Compete Rank / Count | Quantcast Rank | Google PageRank |
|---|---|---|---|
| 48,085 | ~ / ~ | ~ |
| Traffic Rank | % of Internet Users | Reach Rank | |
|---|---|---|---|
| Past 1 day: | 70,115 | 0.0026% | 76,776 |
| Past 7 days: | 49,001 | 0.0033% | 55,290 |
| Past 1 month: | 49,262 | 0.0032% | 55,061 |
| Past 3 months: | 48,085 | 0.0033% | 53,024 |
| PageViews Rank | % of Internet PageViews | Page Views Per User | |
| Past 1 day: | 92,734 | 0.000094% | 3.9 |
| Past 7 days: | 51,290 | 0.00015% | 4.7 |
| Past 1 month: | 50,849 | 0.000145% | 4.6 |
| Past 3 months: | 50,146 | 0.000144% | 4.43 |
| Users | Country | Rank Within Country | % of overall PageViews |
|---|---|---|---|
| 90.0% | 9,903 | 94.6% | |
| 1.7% | 210,783 | 1.2% | |
| 8.3% | Other Countries | ~ | 4.3% |
| Users | City | Rank in City | % of overall PageViews |
|---|---|---|---|
| 66.6% | 417 | 75.4% | |
| 1.9% | 2,726 | 2.0% | |
| 1.6% | 30,051 | 1.8% | |
| 30.0% | OTHER | ~ | 20.8% |
Site Disclaimer:
All trademarks are the property of their respective owners. The facts, figures, reviews, records, stats, and other data presented on this page is for suggestion and information purposes only. PageGlimpse.com is not responsible for any incorrect or incomplete information. PageGlimpse.com does not take responsibility for any user-reviews of websites inside its resource and reserves the right to keep or remove those. It is highly recommended that you review all the data for accuracy.
All trademarks are the property of their respective owners. The facts, figures, reviews, records, stats, and other data presented on this page is for suggestion and information purposes only. PageGlimpse.com is not responsible for any incorrect or incomplete information. PageGlimpse.com does not take responsibility for any user-reviews of websites inside its resource and reserves the right to keep or remove those. It is highly recommended that you review all the data for accuracy.
CONTENT
TRAFFIC INFO
REVIEWS
COUPONS
SERVER
WEB RESULTS