biocomp.unibo.it
Biocomputing Group - University of BolognaBologna Biocomputing Bioinformatics Group
http://biocomp.unibo.it/
Bologna Biocomputing Bioinformatics Group
http://biocomp.unibo.it/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
2.3 seconds
16x16
32x32
64x64
128x128
160x160
192x192
PAGES IN
THIS WEBSITE
15
SSL
EXTERNAL LINKS
92
SITE IP
137.204.193.11
LOAD TIME
2.268 sec
SCORE
6.2
Biocomputing Group - University of Bologna | biocomp.unibo.it Reviews
https://biocomp.unibo.it
Bologna Biocomputing Bioinformatics Group
Biocomputing Group - University of Bologna
Welcome to the Bologna Biocomputing Group. Node of the BioSapiens Network of Excellence. Member of the European Computational Biology Community. Member of the ELIXIR-IIB. Italian node of ELIXIR. Member of the Bologna Computational Biology Network. Italian node of the FIRB project 2001-2003: " Bioinformatics for Genomics and Proteomics". FIRB 2003-LIBI - International Laboratory of Bioinformatics. Member of the Centre of Genome Biology. Member of the COST Action TD1101: RGB-Net.
The Prediction Servers @ Bologna Biocomputing Unit
Welcome to the BIOCOMP.UNIBO prediction server. TRAMPLE: the transmembrane protein labelling environment. PONGO : a web server for multiple predictions of all-alpha transmembrane proteins. Balanced subCellular Localization predictor. Predictor of Coiled-Coils Regions in Proteins. Predictor of Coiled-Coils Regions in Proteins exploiting evolutionary information. Predictor of Residue Contacts in Proteins. Predictor of Disulfide Connectivity in Proteins. Predictor of Protein Interaction Sites. Database of p...
The Prediction Servers @ Bologna Biocomputing Unit
Welcome to the BIOCOMP.UNIBO prediction server. TRAMPLE: the transmembrane protein labelling environment. PONGO : a web server for multiple predictions of all-alpha transmembrane proteins. Balanced subCellular Localization predictor. Predictor of Coiled-Coils Regions in Proteins. Predictor of Coiled-Coils Regions in Proteins exploiting evolutionary information. Predictor of Residue Contacts in Proteins. Predictor of Disulfide Connectivity in Proteins. Predictor of Protein Interaction Sites. Database of p...
Bologna Annotation Resource 3.0
BAR 30 Bologna Annotation Resource. Protein functional and structural annotation. Accepted queries: Uniprot accession. Ligand code, NCBI taxonomy id. Data-validation-error-msg="Please specify only one FASTA sequence, complete with header, with a length in range 40-11000" class="form-control". Or upload a FASTA file. Sample sequence MTLSHSALQFWTHLYLWCLLLVPAVLTQQGSHTHAEDRLFKHLFGGYNRWARPVPNTSDV VIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNVTSLRVPSEMIWIP DIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQN...
BetAware - Bologna Biocompunting Group
Detection and topology predcition of outer-membrane β-barrels in prokaryotes. Welcome to the BetAware TMBB prediction server. BetAware is a web server for TransMembrane β-Barrel (TMBB) detection and topology prediction. Both prediction steps are based on advanced machine-learning methods. For TMBB detection, BetAware exploits a new machine learning approach based on N-to-1 Extreme Learning Machines, while TMBB topology prediction is carried-out using a probabilistic model based on Grammatical-Res...Predi...
DisLocate - Bologna Biocomputing Group
Find Disulfide bonds in Eukaryotes with predicted subcellular Localization. Welcome to the DisLocate prediction server. DisLocate is a method based on Grammatical-Restrained Hidden Conditional Random Fields (GRHCRFs) and Support Vector Regression (SVR) for the prediction of cysteine connectivity patterns in a protein chain. The method takes advantage of the protein subcellular localization as predicted by the BaCelLo predictor. 2011) 27 (16): 2224-2230. Fill with a test sequence. Retrieve your job results.
INPS - Bologna Biocomputing Group
The INPS-MD prediction server. The INPS-MD (Impact of Non-synonymous mutations on Protein Stability - Multi Dimension) is a web server devised to prediction of protein stability change upon single point mutation. At the moment, two versions of the predictor are available either using protein sequence or 3D structure as starting point for the prediction task:. INPS predictor from sequence. INPS predictor from protein 3D structure. 2015) 31 (17): 2816-2821.
TPpred
The majority of nuclear-encoded mitochondrial protein precursors have an N-terminal presequence that serves as a targeting sequence. Process the presequence and annotate its putative targeting to mitochondria. Analyse which cleavage site motif is present in the presequence. Please, paste a single protein sequence in FASTA. Format (the minimal accepted length is 20 residues):.
TPpred 2.0 - Bologna Biocomputing Group
Detection of mitochondrial-targeting signals in proteins. Welcome to the TPpred 2.0 prediction server. TPpred 2.0 is a web server for MITOCHONDRIAL. Targeting peptides prediction in proteins. TPpred 2.0 is optimized for the prediction of cleavage sites of mitochondrial targeting peptides. Please, be aware that submitting plastidic plant proteins may lead to an erroneous prediction of the cleavage site. Fill with a test sequence. Retrieve your job results. In this web site we make use of "Technical Cookie...
TPpred 3.0 - Bologna Biocomputing Group
Detection of targeting signals in Eukaryotic proteins. Welcome to the TPpred 3.0 prediction server. TPpred 3.0 is a web server for targeting peptides prediction in Eukaryotic proteins. TPpred 3.0 is optimized for the prediction of cleavage sites of both mitochondrial and chloroplastic targeting peptides. Savojardo C., Martelli P.L., Fariselli P., Casadio R. "TPpred3 detects and discriminates mitochondrial and chloroplastic targeting peptides in Eukaryotic proteins". Fill with a test sequence. In this web...
Rabbit Genome Biology Network
http://biocomp.unibo.it/rabbit
RGB-Net: a Collaborative European Network on Rabbit Genome Biology. About RGB-Net (COST Action TD1101). In this web site we make use of "Technical Cookies". The technical Cookies are needed to show our web page, make it work correctly. These technical cookies are necessary for our web page to function properly. For more information please see: UniBo policies.
Biocomputing Group - University of Bologna
http://biocomp.unibo.it/conferences.html
Bologna Biocomputing Group - Via San Giacomo 9/2 - 40126 Bologna. In this web site we make use of "Technical Cookies". The technical Cookies are needed to show our web page, make it work correctly. These technical cookies are necessary for our web page to function properly. For more information please see: UniBo policies.
Biocomputing Group - University of Bologna
http://biocomp.unibo.it/fields.html
Group Main Research Fields. Prediction of protein secondary structure and of membrane protein topology with machine learning approaches. Protein folding prediction from aminoacid sequence: statistical potentials, contact maps for 3D structure prediction, distance geometry, recognition of nucleation sites, prediction of disulfide bridges with neural networks, prediction of the topology of membrane proteins, model building by homology, threading. Structural and functional annotation of proteomes.
International Bologna Master in Bioinformatics
http://biocomp.unibo.it/lsbioinfo
News and Job Offers. Welcome to the web page of the. International Bologna Master in Bioinformatics. Laurea Magistrale in Bioinformatics. LM Bioinformatics - UNIBO. International Bologna Master in Bioinformatics - University of Bologna.
Biocomputing Group - University of Bologna
http://biocomp.unibo.it/bws.html
Bologna Biocomputing Group - Via San Giacomo 9/2 - 40126 Bologna. In this web site we make use of "Technical Cookies". The technical Cookies are needed to show our web page, make it work correctly. These technical cookies are necessary for our web page to function properly. For more information please see: UniBo policies.
TOTAL PAGES IN THIS WEBSITE
15
coffyybioinformatics.blogspot.com
Where is bioinformatics done? | Bioinformatics
http://coffyybioinformatics.blogspot.com/p/where-is-bioinformatics-done.html
Where is bioinformatics done? What bioinformatics Websites are there? Where can I study Bioinformatics. List of grad schools. Bioinformatics - Miscellaneous collection. Follow us on Facebook. View my complete profile. Where is bioinformatics done? Where is bioinformatics done? The biggest and best source of bioinformatics links I have encountered is the Genome Web. At the Rosalind Franklin Centre for Genomics Research. At the Genome Campus. Virtual" centres (for example consortia and communities). Intern...
NETTAB 2002 Workshop: Scientific Programme
http://www.nettab.org/2002/progr.html
July 12th - 14th, 2002. Ex Scuola Ercolani, University of Bologna,. Mura Anteo Zamboni 2b, Bologna, Italy. Telematics Applications in Biotechnology. National Cancer Research Institute - Genova. Introduction to the workshop. Agents in Bioinformatics: the reasons for a workshop now. Paolo Romano, Biotechnology Department, National Cancer Research Institute. The implementation of the Semantic Web. Ian Horrocks, Computer Science Department, University of Manchester. Paolo Ciancarini, University of Bologna.
INPS - Bologna Biocomputing Group
http://inpsmd.biocomp.unibo.it/inpsSuite/default/software
S2648 Dataset - Homology-based cross-validation split. Original dataset publication: Dehouck. 2009) Fast and accurate predictions of protein stability changes upon mutations using statistical potentials and neural networks: PoPMuSiC-2.0. Bioinformatics, 25, 2537 2543. This datasets, originally released by Dehouck.
Emidio Capriotti - BioFolD - Resources
http://www.biofold.org/pages/resources.html
The researchers of the BioFolD Unit have developed several web server applications that are currently hosted on this server and other servers at the University of Bologna. Italy) and manatined by other collaborators. In the future a mirror of these applications will be made available on this server. Currently you can reach these web servers using the following links. Neural Network based method to predict the sign of free energy change of proteins upon single point mutation.
Pattern Recognition in Bioinformatics 2010
http://www.prib2010.org/conferencesite.html
Call for Short Papers. Costumer service number Geico. The Pattern Recognition in Bioinformatics conference aims to bring together top researchers, practitioners and students from around the world to discuss the applications of pattern recognition methods in the field of bioinformatics to tackle problems in the life sciences. Prospective authors are invited to submit papers in the research areas of interest to the conference. These include:. Gene and protein expression analysis. Motifs and signal detection.
Pattern Recognition in Bioinformatics 2010
http://www.prib2010.org/social_events.html
Call for Short Papers. Costumer service number Geico. The Pattern Recognition in Bioinformatics conference aims to bring together top researchers, practitioners and students from around the world to discuss the applications of pattern recognition methods in the field of bioinformatics to tackle problems in the life sciences. Prospective authors are invited to submit papers in the research areas of interest to the conference. These include:. Gene and protein expression analysis. Motifs and signal detection.
Pattern Recognition in Bioinformatics 2010
http://www.prib2010.org/accommodation.html
Call for Short Papers. Costumer service number Geico. The Pattern Recognition in Bioinformatics conference aims to bring together top researchers, practitioners and students from around the world to discuss the applications of pattern recognition methods in the field of bioinformatics to tackle problems in the life sciences. Prospective authors are invited to submit papers in the research areas of interest to the conference. These include:. Gene and protein expression analysis. Motifs and signal detection.
Pattern Recognition in Bioinformatics 2010
http://www.prib2010.org/dates.html
Call for Short Papers. Costumer service number Geico. The Pattern Recognition in Bioinformatics conference aims to bring together top researchers, practitioners and students from around the world to discuss the applications of pattern recognition methods in the field of bioinformatics to tackle problems in the life sciences. Prospective authors are invited to submit papers in the research areas of interest to the conference. These include:. Gene and protein expression analysis. Motifs and signal detection.
TOTAL LINKS TO THIS WEBSITE
92
The Costes Lab
The Lawrence Berkeley Lab. The Costes laboratory specializes on various aspect of computational biology. Areas of expertise:. Modeling and radiation system biology. Analysis of gene expression and sequencing. NASA Specialized Center of Research (NSCOR). Analysis of gene expression in mouse mammary glands exposed to cosmic radiation. Modeling DNA damage patterns in human cells exposed to cosmic radiation. Modeling disruption of organized cell population following ionizing radiation. We are currently estab...
Research - Bozdag Lab
The research goal of my group is to develop open-source computational tools that integrate high throughput biological datasets i) to reverse engineer disease-specific gene regulatory networks and ii) to compute predictive models for biological processes and clinical outcomes. Figure 1. The flowchart of ProcessDriver. In my group’s most recent work, we developed a tool called ProcessDriver. Bithi Bose passed the comprehensive exam. Congratulations Bithi! January 22, 2018. December 18, 2017. August 28, 2017.
Recycled Technology, Pre-Owned, Used Equipment Sale, Trade, Exchange. Main Index Product Categories Listing.
Recycling technology since 1988, The WYSIWYG Place.
BIOCOMP - Producător lămpi și dispozitive bactericide
Lămpi examinare cu halogen. Lămpi examinare scialitice cu LED. Îți dau bătăi de cap? Le poți elimina rapid! Îți pun produsele în pericol? Le poți elimina rapid! Îți dă bătăi de cap? Îl poți elimina rapid! Și frica de a te. Vrei să scapi uşor de boli? Vrei să ai cele mai sigure produse de pe piaţă? Locul tău de muncă este cel mai sigur? Mediul tău de lucru este dezinfectat? Vrei să scapi de virusuri, bacterii, mucegai? Nici nu te mai gândi la ele! De câte ori te-ai îmbolnăvit în ultima vreme? Producem în ...
National Biocomputation Center - Stanford University School of Medicine
A guide in your house. Show yourself more beautiful. Tourism places you need to go. How to choose your vehicle. Creating new products to earn. How to loss your fat. Vehicle insurance choosing tips. How train your muscles. Choose best decoration for you house. How many insurance tips exist. Whats is new in tech. Which business best for me. How to choose correct companies. How to choose best product. How to make home business. Guide in your business. Types of different businesses. How to decore your home.
Biocomputing Group - University of Bologna
Welcome to the Bologna Biocomputing Group. Node of the BioSapiens Network of Excellence. Member of the European Computational Biology Community. Member of the ELIXIR-IIB. Italian node of ELIXIR. Member of the Bologna Computational Biology Network. Italian node of the FIRB project 2001-2003: " Bioinformatics for Genomics and Proteomics". FIRB 2003-LIBI - International Laboratory of Bioinformatics. Member of the Centre of Genome Biology. Member of the COST Action TD1101: RGB-Net.
National Biology Competition | University of Toronto
Since 1995, providing secondary school students the opportunity to test their knowledge and understanding of biology. School code or email: *. Create new school account. 2018 Dates and Deadlines. Monday, January 22. Friday, March 9. Thursday, April 26. University of Toronto Schools. For placing first among 263 schools (215 teams) in Canada in 2017. UTS also placed first in Canada in 2014, 2015 and 2016! The members of the 2017 school team, each of whom are a. National Biology Scholar with Distinction.
Michael H. Coen | Biologically-Inspired Computation Group
BMI/CS/Psych 841 (Fall '14). Michael H. Coen. Department of Biostatistics and Medical Informatics. School of Medicine and Public Health. Department of Computer Sciences. College of Letters and Science. 6785 Medical Sciences Center (MSC). Email: mhcoen@cs.wisc.edu. A map for finding my office. My primary research interest is self-supervised. The Organizing Committee for the AAAI Fall Symposium on Naturally Inspired Artificial Intelligence. And the Program Committees for IJCAI'09. And Medical Scientist Tra...
biocomp2012.ipc.shizuoka.ac.jp
Biocomp2012
November 27 - 30, 2012. Shizuoka Convention and Arts Center GRANSHIP. Conference Hall (11F) / Conference Rooms (9F).
Biocomp 13th Pacific Rim Bio-Based Composite Symposium
Dr Roger M. Rowell. Prof Dr. Andreas Michanickl. Dr Warren J. Grigsby. Dr Danny E. García. Prof Dr. Juan Matos Lale. Dr Roger M. Rowell. Prof Dr. Andreas Michanickl. Dr Warren J. Grigsby. Dr Danny E. García. Prof Dr. Juan Matos Lale. Fragment of "Presencia de América Latina" (Presence of Latin America),mural painted by Mexican artist Jorge González Camarena, located in the lobby of the Art Museum of the University of Concepción. Dean of the Faculty of Built Environment, University of Primorska, Slovenia.