cookieswithchristel.blogspot.com
Cookies With ChristelVegan Treats, Eats and Good Finds.
http://cookieswithchristel.blogspot.com/
Vegan Treats, Eats and Good Finds.
http://cookieswithchristel.blogspot.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
0.5 seconds
PAGES IN
THIS WEBSITE
1
SSL
EXTERNAL LINKS
38
SITE IP
172.217.11.33
LOAD TIME
0.518 sec
SCORE
6.2
Cookies With Christel | cookieswithchristel.blogspot.com Reviews
https://cookieswithchristel.blogspot.com
Vegan Treats, Eats and Good Finds.
Cookies With Christel: New Posts at http://cookieswithchristel.tumblr.com/
http://cookieswithchristel.blogspot.com/2011/03/new-posts-at-httpcookieswithchristeltum.html
Vegan Treats, Eats and Good Finds. Monday, March 28, 2011. New Posts at http:/ cookieswithchristel.tumblr.com/. I am rarely at my computer so tumblr allows for more mobile fun times. Subscribe to: Post Comments (Atom). Follow this blog with bloglovin. Cherry Blossoms on Church st. San Francisco, California, United States. View my complete profile. Quote I like by Norman Cousins. The Dogger in Her Natural Habitat. Chad and Me @ Haiti Aid @ Mezzanine. Thanks Ava Berlin for the cute photo.
TOTAL PAGES IN THIS WEBSITE
1
acupofchaiwithfeatherheart.blogspot.com
a cup of chai: ohmygoodnessplanningaweddingkeepsmeawayfrommyblogbutcheckoutthesesummersolsticeherbwalkphotos
http://acupofchaiwithfeatherheart.blogspot.com/2010/06/ohmygoodnessplanningaweddingkeepsmeaway.html
A cup of chai. Wednesday, June 23, 2010. The linden's in bloom. And the plantain is everywhere. Red clovers and daisies oh my. And the lovely yarrow. And alas miss nettle. June 29, 2010 at 5:39 PM. Growing beauties do my heart so much good. i cant wait to hear more about your wedding, july 4 right? Did you ever find that vintage dress you wanted? Best of luck, grace, beauty and kindness to you and your wedding, the whole shebang. i bet itll be grand. much love. Subscribe to: Post Comments (Atom).
acupofchaiwithfeatherheart.blogspot.com
a cup of chai: a little poem for midsummers...
http://acupofchaiwithfeatherheart.blogspot.com/2010/05/little-poem-for-midsummers.html
A cup of chai. Friday, May 7, 2010. A little poem for midsummers. My little dog sleeping by my side. Kitty cleaning her paws. And shedding some of her winter coat. Makes me crazy to clean it up,. But tells me warmth is near and all things are preparing. And soon tiny greenery popping through the soil. Of my brown dirt garden. Of seeds sown lovingly. This is what i live for! May 12, 2010 at 1:09 PM. I love this and i LOVE your animals! Your kitty is beautiful.is she polydactyl? June 7, 2011 at 10:30 PM.
acupofchaiwithfeatherheart.blogspot.com
a cup of chai: read this!
http://acupofchaiwithfeatherheart.blogspot.com/2010/12/read-this.html
A cup of chai. Saturday, December 11, 2010. So my good friend andrea just interviewed me for her folk reveries blog. folk reveries is an amazing team of crafters that can be found on etsy and i just happen to be part of this extraordinary team. check it out! Beware. each member of folk reveries crafts to die for items that you might not be able to resist! Just click on the adorable folk reveries icon to be swept away to a magical world! December 31, 2010 at 10:42 AM. Subscribe to: Post Comments (Atom).
acupofchaiwithfeatherheart.blogspot.com
a cup of chai: August 2010
http://acupofchaiwithfeatherheart.blogspot.com/2010_08_01_archive.html
A cup of chai. Friday, August 6, 2010. Ok i'm married. now back to blogging! Subscribe to: Posts (Atom). Http:/ www.featherheartflower.etsy.com. There was an error in this gadget. Ok im married. now back to blogging! Gypsy ramblin', mother earth lovin', alien enthusiast living in miss michigan. View my complete profile. Octonauts Birthday for my little Explorer. Interview with Ally Shaw of Feral Strumpet. 9790;◎▼❅▲◉☽. A chain of events. New Posts at http:/ cookieswithchristel.tumblr.com/. A cup of chai.
acupofchaiwithfeatherheart.blogspot.com
a cup of chai: June 2010
http://acupofchaiwithfeatherheart.blogspot.com/2010_06_01_archive.html
A cup of chai. Wednesday, June 23, 2010. The linden's in bloom. And the plantain is everywhere. Red clovers and daisies oh my. And the lovely yarrow. And alas miss nettle. Subscribe to: Posts (Atom). Http:/ www.featherheartflower.etsy.com. There was an error in this gadget. Gypsy ramblin', mother earth lovin', alien enthusiast living in miss michigan. View my complete profile. Octonauts Birthday for my little Explorer. Interview with Ally Shaw of Feral Strumpet. A chain of events. A cup of chai.
acupofchaiwithfeatherheart.blogspot.com
a cup of chai: November 2009
http://acupofchaiwithfeatherheart.blogspot.com/2009_11_01_archive.html
A cup of chai. Monday, November 23, 2009. What's on the turntable. Thursday, November 19, 2009. A really good sweet potato recipe. Okay, so i just thought i'd share an extremely delicious recipe for brandied candied yams for those of you looking for a new addition to your thanksgiving. it is seriously soooo good and has become a family and friend favorite. you won't be disappointed! 5-6 yams or sweet potatoes cooked (about 2 1/2 lbs). 1/2 cup packed brown sugar. 1/4 cup butter melted. So I was kid sittin...
acupofchaiwithfeatherheart.blogspot.com
a cup of chai: February 2011
http://acupofchaiwithfeatherheart.blogspot.com/2011_02_01_archive.html
A cup of chai. Thursday, February 3, 2011. Subscribe to: Posts (Atom). Http:/ www.featherheartflower.etsy.com. There was an error in this gadget. Gypsy ramblin', mother earth lovin', alien enthusiast living in miss michigan. View my complete profile. Octonauts Birthday for my little Explorer. Interview with Ally Shaw of Feral Strumpet. 9790;◎▼❅▲◉☽. A chain of events. New Posts at http:/ cookieswithchristel.tumblr.com/. A cup of chai.
acupofchaiwithfeatherheart.blogspot.com
a cup of chai: abundance!
http://acupofchaiwithfeatherheart.blogspot.com/2010/05/abundance.html
A cup of chai. Saturday, May 15, 2010. The vegetable garden is finally in! And the lawn gnomes and fairies are hard at work! Subscribe to: Post Comments (Atom). Http:/ www.featherheartflower.etsy.com. There was an error in this gadget. Adventures in whats growing in my yard. A little poem for midsummers. Gypsy ramblin', mother earth lovin', alien enthusiast living in miss michigan. View my complete profile. Octonauts Birthday for my little Explorer. Interview with Ally Shaw of Feral Strumpet.
acupofchaiwithfeatherheart.blogspot.com
a cup of chai: February 2010
http://acupofchaiwithfeatherheart.blogspot.com/2010_02_01_archive.html
A cup of chai. Wednesday, February 24, 2010. Chi chi chi chia. The very next day i saw the beverage at a restaurant and ordered it. it was delicious. the tiny seeds were mucilaginous and so fun to slide around in my mouth. i was sure that the beverage was probably good for digestion given the mucousy texture, but what i hadn't yet connected was that the seed and plant i was enjoying was chia! 1 to 2 inches of ginger. Blend and add 5-8 brazil nuts or a handful of cashews or almonds. Add 1/2 tsp cinnamon.
acupofchaiwithfeatherheart.blogspot.com
a cup of chai: December 2010
http://acupofchaiwithfeatherheart.blogspot.com/2010_12_01_archive.html
A cup of chai. Saturday, December 11, 2010. So my good friend andrea just interviewed me for her folk reveries blog. folk reveries is an amazing team of crafters that can be found on etsy and i just happen to be part of this extraordinary team. check it out! Beware. each member of folk reveries crafts to die for items that you might not be able to resist! Just click on the adorable folk reveries icon to be swept away to a magical world! Subscribe to: Posts (Atom). There was an error in this gadget.
TOTAL LINKS TO THIS WEBSITE
38
cookieswithattitude.com - This domain may be for sale!
Find the best information and most relevant links on all topics related to cookieswithattitude.com. This domain may be for sale!
Cookies with Boys
cookieswithcharacter.blogspot.com
Cookies with Character
Wednesday, June 18, 2014. Mason Jar Cookie Tutorial. I have been wanting to do these two tutorials for a long time and finally have gotten to it! You can find my ZINNIA FLOWER COOKIE TUTORIAL HERE. My very first Jar Cookie was made for a 90th Birthday back in 2012. I will always love these the most. You can see more of these cookies and the fabulous party, by Gretchen of Three Little Monkeys Studio, HERE. Photo courtesy of Gretchen at Three Little Monkeys Studio). Since then, I've made them in large sizes.
Web Page Under Construction
This Site Is Under Construction and Coming Soon. This Domain Is Registered with Network Solutions.
www.cookieswithcharacter.net
Where the love of cookies and the love of art collide! Create a free website. Start your own free website. A surprisingly easy drag and drop site creator. Learn more.
cookieswithchristel.blogspot.com
Cookies With Christel
Vegan Treats, Eats and Good Finds. Monday, March 28, 2011. New Posts at http:/ cookieswithchristel.tumblr.com/. I am rarely at my computer so tumblr allows for more mobile fun times. Monday, December 6, 2010. Fettucine with vegan Alfredo sauce, kale and baked butternut squash. I found the Alfredo Sauce recipe on the Vegan Yum Yum site. 1/3 Cup Raw, Unsalted Cashews- I used more like a 1/2 off a cup. 1/4 Cup Nutritional Yeast. 3 Tbs Low-Sodium Tamari or Soy Sauce. 2 Tbs Earth Balance Margarine. In Berkele...
Coming Soon - Future home of something quite cool
Future home of something quite cool. If you're the site owner. To launch this site. If you are a visitor. Please check back soon.
Cookies With Cream - The State Of The Art Twenty Thirteen
Cookies With Cream - The State Of The Art Twenty Thirteen.
cookieswithdorienyc.wordpress.com
Cookies with Dorie & Cookie Bar NYC | A food blogger meetup to celebrate Dorie Greenspan
Cookies with Dorie and Cookie Bar NYC. A food blogger meetup to celebrate Dorie Greenspan. Cookies on Feb 11 at Noon. February 4, 2011 8 Comments. OK, we have a date and time. Join us for the blogger gathering to celebrate Dorie and Josh Greenspan at CookieBar NYC. Friday, February 11 from 12:00 – 2:00 pm (drop in anytime, but @thepeche. Will be there to say hi after you’re done basking in Dorie’s glow). Mizu Salon, 505 Park Ave, New York NY 10022. CookieFest on February 11. January 28, 2011 4 Comments.
cookieswithfriends.wordpress.com
Cookies with Friends
August 14, 2016. This particular recipe contains lemon curd, far from the healthiest of foods, but it actually comes with a lower calorie count than some of its counterparts (Orange Cranberry Oatmeal and Spiced Apple Oatmeal…recipes coming soon) despite the added sugar and fat. The key here is portions. I made Microwave Lemon Curd. 1 1/4-1 1/2 C water. 1/4 C steel cut oats*. 2 Tbsp prepared lemon curd. 1/4 C fresh or frozen blueberries (thawed). 1 tsp lemon zest, optional. 1/2 C butter, melted. Whisk tog...
Bandwidth Overage
This site has exceeded the allotted bandwidth. Information for site owners:. Web hosting packages have different monthly bandwidth allowances. If you require additional bandwidth on a regular basis, a different package may be necessary. To upgrade your hosting package, log in to Support Portal. Hosted by Web.com.