drivingschoolsoxford.com
Home | Driving Instructor | Oxford | Mike Stickleys Driving School UK
Welcome to Mike Stickley's Driving School. Thinking of learning to drive? Know someone who is looking for a patient, reliable instructor? I offer a reliable, patient and structured driving tuition to suit your needs in the Abingdon and Oxford areas, including the surrounding villages. As a fully qualified ADI and member of the DIA, I can offer flexible pick up / drop off points with prior arrangement, so call me to discuss your needs. Live outside this area? Then call me and we can discuss your options.
drivingschoolspain.com
Driving School Spain | English Driving School
DGT Test Ingles English Driving School. We Give Best Offers For You. Obtain your spanish driving license in English, all you need to pass the official theory test in English. Learning to Driving School Spain. As Spain does not have a Provisional Licence system, the only person who can teach you to drive is a registered driving instructor. A Spanish driving licence is the standard EU model: a plastic, credit card-sized permit with photograph. Application and application fee. A set number of hours of train...
drivingschoolspecialist.com
Driving School Specialist
Click here to proceed.
drivingschoolspenzance.co.uk
www.drivingschoolspenzance.co.uk is not currently active
Is not currently active. Sorry, the page or site that you are looking is currently not active. If you are the owner of this website please contact info@ems-internet.co.uk. Or call 44 (0) 844 7041 612. We offer a range of affordable website design packages to suit any budget. We will design and build a professional website for your business helping to generate you more business throughout the year. Call us today to find out more. Want to sell your products online?
drivingschoolspenzance.mobi
www.drivingschoolspenzance.mobi is not currently active
Is not currently active. Sorry, the page or site that you are looking is currently not active. If you are the owner of this website please contact info@ems-internet.co.uk. Or call 44 (0) 844 7041 612. We offer a range of affordable website design packages to suit any budget. We will design and build a professional website for your business helping to generate you more business throughout the year. Call us today to find out more. Want to sell your products online?
drivingschoolsperth.com.au
drivingschoolsperth.com.au
The Sponsored Listings displayed above are served automatically by a third party. Neither the service provider nor the domain owner maintain any relationship with the advertisers. In case of trademark issues please contact the domain owner directly (contact information can be found in whois).
drivingschoolsphiladelphiapapennsylvaniastickshiftclasses.com
Driving School, Driving Lessons | Pennsylvania
Where Safe Drivers Are Born Since 1976. Driving Lessons in The Delaware Valley. All PA Suburbs of Philadelphia and The Entire City. We make Driver's Ed a pleasent experience. Learning how to drive well and with confidence is an easy skill that can be taught. CONFIDENT DRIVING SCHOOL. Offers affordable and professional driving lessons that help you get your license. Learn how to drive confidently at our driving school. Us for our behind the wheel and online driver education classes. Driving You to Success.
drivingschoolspittsburgh.com
Driving School | Driving Lessons | Pittsburgh PA
For Behind-The-Wheel Lessons, Call:. Behind The Wheel Lessons. Cindy Cohen School of Driving, LLC. Rated #1 in Pittsburgh for Behind The Wheel Lessons. Bull; Behind the Wheel Instruction. Bull; Online Theory Classes. Bull; Driver's Education Classroom. Bull; Private Tutoring for the Knowledge Test. Bull; Senior Citizen Evaluations. Bull; Defensive Driving Course. Bull; Pennsylvania Road Test. Bull; Mock Driving Test (at the DMV, in which the student will practice for the driving exam). Bull; Stow-Rocks H...
drivingschoolsplymouth.co.uk
.: ComPass Driving School - Driving Schools Plymouth - Driving Lessons and Driving Courses :.
Hello and welcome to the Compass driving School website. Com'Pass is a family run school with over 25 years of experience and are Plymouth's largest independent driving school. We provide professional, friendly tuition in and around the Plymouth area. We also offer Pass Plus and Advanced Driving training for those who have already passed your test and wish to further improve on your driving skills. Designed and developed by Henderson Web Design Ltd.
drivingschoolspoole.com
Driving lessons Poole 1st 2 Hr lesson £10
Instructors Needed in Poole. Get a 2 Hour Driving Lesson in. We have been helping the good people of Poole, Canford Heath, Hamworthy and surrounding areas to drive for over 25 years. You to can discover your freedom by contacting us today. Don’t worry if you are a beginner as our instructors are used to putting people at ease and planning out a course of lessons to help you pass your test with little fuss. Your instructor will take care of everything for you. You are in safe hands. The first 2 hour lesso...
drivingschoolsportsmouth.com
Driving lessons Portsmouth 1st 2 Hr lesson £10
Driving Lessons in Portsmouth. Instructors Needed in Portsmouth. Get a 2 Hour Driving Lesson in. We have been helping the good people of Portsmouth, Chichester, Isle of Wight and surrounding areas to drive for over 15 years. You to can discover your freedom by contacting us today. We take great delight when we see our ex pupils driving confidently around Portsmouth, Chichester and Isle of Wight in their own cars. The first 2 hour lesson will only cost you 10 and you can pay this direct to your instructo...