Family and Kids-Care Foundation Inc is a leading Queensland charity with an annual income and expenditure of over one million dollars, helping over 15,000 disadvantaged people annually, with this figure steadily rising.
http://familyandkidscare.com.au/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Friday
LOAD TIME
2.1 seconds
16x16
32x32
64x64
128x128
160x160
192x192
PAGES IN
THIS WEBSITE
13
SSL
EXTERNAL LINKS
1
SITE IP
162.241.217.45
LOAD TIME
2.069 sec
SCORE
6.2
familyandkidscare | familyandkidscare.com.au Reviews
https://familyandkidscare.com.au
Family and Kids-Care Foundation Inc is a leading Queensland charity with an annual income and expenditure of over one million dollars, helping over 15,000 disadvantaged people annually, with this figure steadily rising.
familyandkidscare.com.au
Donations | Family & Kids-Care Foundation Inc
http://www.familyandkidscare.com.au/donations
IA 17854 ABN 42 949 186 521. 254 Jacaranda Ave, Kingston Qld 4114. Tel (07) 3808 5288. Fax (07) 3808 5068. One Social Housing System. Family and Kids-Care Foundation Inc. is a registered charity, non-profit organisation with both deductible gift and benevolent status. The Foundation was established in 1992 for the disadvantaged in the community in need of a wide variety of Social Welfare Services. Funds generated from this site will go towards:. Counselling to those whose lives are unsettled. We need you...
Hugs Week | Family & Kids-Care Foundation Inc
http://www.familyandkidscare.com.au/hugs-week
IA 17854 ABN 42 949 186 521. 254 Jacaranda Ave, Kingston Qld 4114. Tel (07) 3808 5288. Fax (07) 3808 5068. One Social Housing System. Hugs Week is in the first week of September each year. It is a week filled with wonderful events, love and yes.hugs! Start browsing what weve got in store this year by clicking on the menu above. IA 17854 ABN 42 949 186 521. Email: info@familyandkidscare.com.au. Phone: (07) 3808 5288. Web site design by Carbon Websites.
Plans | Family & Kids-Care Foundation Inc
http://www.familyandkidscare.com.au/plans
IA 17854 ABN 42 949 186 521. 254 Jacaranda Ave, Kingston Qld 4114. Tel (07) 3808 5288. Fax (07) 3808 5068. One Social Housing System. Information regarding the One Social Housing System. The One Social Housing System includes all products, services and programs provided, funded or subsidised by the Department of Communities (Housing and Homelessness Services) ranging from being subsidy assistance, such as direct provision of housing, to other products such as private housing assistance. The One Social Ho...
Accommodation | Family & Kids-Care Foundation Inc
http://www.familyandkidscare.com.au/accommodation
IA 17854 ABN 42 949 186 521. 254 Jacaranda Ave, Kingston Qld 4114. Tel (07) 3808 5288. Fax (07) 3808 5068. One Social Housing System. Homelessness is a growing concern for all age groups. The Hope Centre is an initiative of Family and Kids-Care Foundation Inc, is an emergency (crisis) accommodation and has nineteen (19) self-contained units. The Hope Centre was purposely built with versatility to accommodate individuals and small families who are homeless. Hope Centre Enquiries- Anna (07) 3208 9578.
Why Hug? | Family & Kids-Care Foundation Inc
http://www.familyandkidscare.com.au/why-hug
IA 17854 ABN 42 949 186 521. 254 Jacaranda Ave, Kingston Qld 4114. Tel (07) 3808 5288. Fax (07) 3808 5068. One Social Housing System. Hugging is a way for us to show our love for each other. What is it about hugging that is so powerful? A quote by Jill Wolf “Hugs don’t need new equipment, special batteries or parts – just open up your arms and open up your hearts”. IA 17854 ABN 42 949 186 521. Email: info@familyandkidscare.com.au. Phone: (07) 3808 5288. Web site design by Carbon Websites.
TOTAL PAGES IN THIS WEBSITE
13
NextGen Studios | Clients | Friends | Brisbane and Gold Coast
http://www.nextgenstudios.net/clients/friends
We support the following organisations by way of financial donations and/or discounted fees for service:. Laurie Lawrence's 'Kids Alive Do The Five'. Family and Kids-Care Foundation. Wayne Armstrong's Executive Alliance. Gold Coast Media & Corporation Club. Digital / Online Formats. Keep up to date.
TOTAL LINKS TO THIS WEBSITE
1
hibu
This site was purchased through our premier business store. Check it out today! Hibu is here to help consumers find local businesses, browse products. And services and buy locally. With a broad range of digital services on offer, hibu can help small. Businesses compete in the online world in next to no time at all. Together, we can help communities thrive. Discover solutions that are easy. To use and knowledge to help your business thrive. Try our products for free. Promote your business today.
Unique you by SRCarville
Unique you by SRCarville. I love natural lighting , outdoors mostly i prefared.I love textures and vintage. but i would love to test my self with different things , i would love to hear from people if i did good or satisfied them with my photos.If you want to hire me as a your photographer pls. give me a call. :). The best inheritance a parent can give. To his children is a few minutes of their time each day! When you photographs people in colour,you photograph their clothes. Reach me @ 970-250-8465.
Family & Kids: Your Advisor in all family-related Questions. From Love to Marriage, from Weddings to Babies and Toddlers.
Your Advisor in all family-related Questions. Welcome to Family And Kids. At FamilyAndKids.info we cover all family-related topics. From Babies to Toddlers, from Love to Marriage and Wedding, from Family Hobbies to Elderly Care. Read more on Baby Girl Clothing. Read more on Causes Of Divorce. Read more on Home School Materials. Read more on Scrapbooking Layout. Read more on Designer Baby Gifts. Bull; Attention Deficit Disorder. Bull; Baby Clothing. Bull; Baby Gifts. Bull; Cards and Gifts. Bull; IT Gadgets.
Price Request - BuyDomains
Url=' escape(document.location.href) , 'Chat367233609785093432', 'toolbar=0,scrollbars=0,location=0,statusbar=0,menubar=0,resizable=0,width=640,height=500');return false;". Need a price instantly? Just give us a call. Toll Free in the U.S. We can give you the price over the phone, help you with the purchase process, and answer any questions. Get a price in less than 24 hours. Fill out the form below. One of our domain experts will have a price to you within 24 business hours. United States of America.
familyandkidscare
Call us now: 61 (07) 3808 5288 Email: admin@familyandkidscare.com.au. Family and Kids Care Foundation. HELP THE DISADVANTAGED and HOMELESS. Hello and Welcome to Family and Kids Care Foundation Inc. Family and Kids Care Foundation Inc aims to develop and provide a wide range of Social Welfare Services to individuals and groups who find themselves in need. Life is about choices. In times of trouble don't be afraid to say I need help. Pick up the phone NOW, don't put it off. Don't forget NEVER. Is on its way.
Children's Dentist | Pueblo, CO | Family & Kids Dental
Family and Kids Dental. 1022 Liberty Lane, Pueblo, CO 81001. Call Us: (719) 545-5778. While children are our focus at Family and Kids Dental, we are currently accepting patients of all ages with a variety of insurance plans. If you are in need of an excellent general dentist, call us today to schedule appointments for the whole family. Friendly, Bilingual Staff. It’s time to visit the dentist! Do your children cringe or are. The mission of Family and Kids Dental is to go beyond just providing. Family and...
familyandkidsdentalservices-mi.net
familyandkidsdentalservices-mi.net - familyandkidsdentalservices-mi Resources and Information.
This Domain Name Has Expired - Renewal Instructions.
Build Our Family Tree - FamilyandKin.com
FamilyandKin a website for our Family… maintained by Telly Myles. Build Our Family Tree – Family and Kin. Welcome to the Family and Kin. Looking for more family information. You can download a editable Family Group Record pdf form by clicking here. When you had added as much information that you want, please send it back so I can update our tree. Please feel free to have a look around at the website, but it is very much a work in progress. I have a lot more information. Statistics as of 12-15-2017.
hibu
This site was purchased through our premier business store. Check it out today! Hibu is here to help consumers find local businesses, browse products. And services and buy locally. With a broad range of digital services on offer, hibu can help small. Businesses compete in the online world in next to no time at all. Together, we can help communities thrive. Discover solutions that are easy. To use and knowledge to help your business thrive. Try our products for free. Promote your business today.
Home · Family & Law
About Family and Law. About this search function. You can search through the full text of all articles by filling in your search term(s) in the search box. If you press the ‘search’ button, search results will appear. This page contains filters, which can help you to quickly find the article you are looking for. At the moment, there are two different filters: category and year. Sign up for email alert. Child protection boards (Raad voor de Kinderbescherming). Civil status (Burgerlijke stand). The forum p...
SOCIAL ENGAGEMENT