keepingitclassless.net
Keeping It ClasslessPerspectives On Networks, Automation, Systems, and Software Engineering
http://www.keepingitclassless.net/
Perspectives On Networks, Automation, Systems, and Software Engineering
http://www.keepingitclassless.net/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
0.2 seconds
16x16
32x32
64x64
128x128
Matthew Oswalt
727 Marti●●●●●●●●●King Dr W
Cin●●●ati , OH, 45220
US
View this contact
Matthew Oswalt
727 Marti●●●●●●●●●King Dr W
Cin●●●ati , OH, 45220
US
View this contact
1&1 Internet Inc.
Hostmaster ONEANDONE
701 ●●●● Rd.
Ches●●●●rook , PA, 19087
US
View this contact
13
YEARS
3
MONTHS
8
DAYS
1 & 1 INTERNET AG
WHOIS : whois.schlund.info
REFERRED : http://1and1.com
PAGES IN
THIS WEBSITE
13
SSL
EXTERNAL LINKS
191
SITE IP
104.28.2.104
LOAD TIME
0.234 sec
SCORE
6.2
Keeping It Classless | keepingitclassless.net Reviews
https://keepingitclassless.net
Perspectives On Networks, Automation, Systems, and Software Engineering
The Two "Network As Code" Domains
https://keepingitclassless.net/2015/05/the-two-network-as-code-domains
Perspectives On The Intersection of Networking and Software Development. The Two "Network As Code" Domains. May 6th, 2015. You’ve probably heard the term network programmability at this point. You probably also heard it equated to anything to do with code, automation, and networking. This was not always the case. I was inspired by a thread that my friend Josh kicked off with this tweet:. Mdash; joshobrien77 (@joshobrien77) April 23, 2015. 1 - Network Ops as Code. So screw all of that - let’s just say tha...
Keeping It Classless
https://keepingitclassless.net/disclaimers
Perspectives On The Intersection of Networking and Software Development. Not affiliated with Vendors, Employers, Customers, Etc. I believe strongly in blogging with integrity. I have signed the pledge. And I believe in everything it says. From time to time, I may also attend events such as those organized by Gestalt IT. 2016 Matt Oswalt with Jekyll.
Big Flowering Thing
https://keepingitclassless.net/2015/07/big-flowering-thing
Perspectives On The Intersection of Networking and Software Development. July 9th, 2015. This is a rant. It borrows emotional (and some verbal) inspiration from Lewis Black’s Big F* king Thing bit. However, in order to keep things light and professional, I will be using the term flower in lieu of the four-letter word that I am using in my head. We keep talking about how the networking industry has been massively disrupted in the past few years, but honestly much of it seems to be centered on vendors and ...
Keeping It Classless
https://keepingitclassless.net/the-unified-engineer
Perspectives On The Intersection of Networking and Software Development. I have adopted a technical mindset called the " Unified Skillset. The voracious need to assimilate new information or solve a problem comes at a price. Many things can be sacrificed to make this happen, but commonly it just ends up being sleep. The Unified Engineer is more aware than anyone that they are not the smartest person in the room. As a result, they crave to be surrounded by really sharp engineers and peers that they re...
Moving Soon!
https://keepingitclassless.net/2015/05/moving-soon
Perspectives On The Intersection of Networking and Software Development. May 16th, 2015. I would like to take the opportunity to let you all know that Keeping It Classless will be moving to a different blogging platform in the near future. For the vast majority of you, this will not be a problem. My intent is to keep as much as possible consistent between moves. 2016 Matt Oswalt with Jekyll.
TOTAL PAGES IN THIS WEBSITE
13
NSX Compendium – Network Inferno
http://networkinferno.net/nsx-compendium
8211; Abstracting the homogeneous from the heterogeneous –. VMware NSX for vSphere. By Anthony Burke – VMware NSBU Senior System Engineer. Disclaimer: This is not an official reference and should be treated as such. Any mistakes on this page are a reflection on my writing and knowledge not the product itself. I endeavour for technical accuracy but we are only human! Whilst NSX for vSphere is very far reaching it is surprisingly light weight. There are only a handful of components that make up this so...
VMware – Network Inferno
http://networkinferno.net/tag/vmware
8211; Abstracting the homogeneous from the heterogeneous –. Testing Distributed Firewall heap usage. The Distributed Firewall in NSX for vSphere is comprised of a number of memory allocations. These memory allocations are also known as heaps. These are allocated based on the amount of physical memory that a server has. The memory heaps are located under /system/heaps on each vSphere host. Under NSX 6.2.2 these are un-named heaps. Under NSX 6.2.3 and later these are named heaps. In certain environments an...
Disclaimer – Network Inferno
http://networkinferno.net/disclaimer
8211; Abstracting the homogeneous from the heterogeneous –. Last updated: October 13, 2012. Public disclosure is required by certain programs, events, vendors, and the FCC. Furthermore, I believe in blogging with integrity such that my readers should be able to trust what I write as my own opinion, and be able to discern anything promotional. I promise to make disclosures on individual pages where appropriate, and to only endorse products and services which I believe in. Some other related posts. Pingbac...
pandom – Network Inferno
http://networkinferno.net/author/admin
8211; Abstracting the homogeneous from the heterogeneous –. License NSX via automation with PowerCLI. Quick one today. As of NSX 6.2.3 and 6.2.4 onwards there are licensing tiers. Standard, Advanced, and Enterprise unlock a different set of features. Whilst I won’t hop on the soap box about that today (buy me a beer and I will) there have been lots of automation efforts using PowerNSX to deploy NSX. Retrieve and store the licence manager and licence assignment manager objects as variables. August 24, 2016.
Postgres – Network Inferno
http://networkinferno.net/tag/postgres
8211; Abstracting the homogeneous from the heterogeneous –. Clearing stale records from NSX Manager. I was working in the lab and I had installed a fresh vCenter 6 Server Appliance into my lab. I seized the hosts from a previous install. What remained was an old installation of NSX (Manager had previous been attached to the old vCenter) and a Log Insight deployment. I had my vCenter running with new hosts and my new DVS built. Secureall=# select * from vdn cluster; id cluster id vlan id ip pool id vmknic...
NOS – Network Inferno
http://networkinferno.net/tag/nos
8211; Abstracting the homogeneous from the heterogeneous –. I have written before. It features all of their functions except SwitchD. It also does not include in ASIC acceleration (given it is not on their white box architecture). This is already running in my Lab in Singapore supporting 4 path Equal Cost Multi Path peer with some static routes to a neutron router. It’s different. Different is good! You can download it free here. You can view the FAQ here. You can view the User Guide here. August 7, 2015.
Cumulus – Network Inferno
http://networkinferno.net/tag/cumulus
8211; Abstracting the homogeneous from the heterogeneous –. I have written before. It features all of their functions except SwitchD. It also does not include in ASIC acceleration (given it is not on their white box architecture). This is already running in my Lab in Singapore supporting 4 path Equal Cost Multi Path peer with some static routes to a neutron router. It’s different. Different is good! You can download it free here. You can view the FAQ here. You can view the User Guide here. August 7, 2015.
Linux – Network Inferno
http://networkinferno.net/tag/linux
8211; Abstracting the homogeneous from the heterogeneous –. I have written before. It features all of their functions except SwitchD. It also does not include in ASIC acceleration (given it is not on their white box architecture). This is already running in my Lab in Singapore supporting 4 path Equal Cost Multi Path peer with some static routes to a neutron router. It’s different. Different is good! You can download it free here. You can view the FAQ here. You can view the User Guide here. August 7, 2015.
Network Inferno – Page 2 – – Abstracting the homogeneous from the heterogeneous –
http://networkinferno.net/page/2
8211; Abstracting the homogeneous from the heterogeneous –. Using PowerCLI to match VTEP binding to hosts. A quick one today on PowerCLI. A colleague asked about how to retrieve a list of VTEPs assigned to a host. I was asked because they though PowerNSX may actually do this but low and behold, good old PowerCLI can do the trick. The use of Get-VMHostNetworkAdapter will help here. What if auto-deploy was assigning them different and across different clusters the VTEP was assigned to a different VMK?
Cisco Champion | Wifijanitor
http://www.wifijanitor.com/category/cisco-champion
Category Archives: Cisco Champion. Schools, Enterprise or Not. May 6, 2016. How important is education? We hear this question all the time. So, how important is our children’s education? Let’s think for a second, what do schools use that equipment for? To educate the next generation. Indeed more and more educational content is being presented online instead of via text books. School assignments are saved to the cloud. Heck even YouTube has educational content on it. In my opinion, they absolutely are, or...
TOTAL LINKS TO THIS WEBSITE
191
Catholics for Retirement |
Scroll down to content. March 20, 2018. March 6, 2018. The ideal Medicare Supplemental Plans For You. Plans A, B, C, D F, High deductible F, G, K,L, M and N are other Medigap plans. Plan A is not optional to companies. Still, rates, plans and insurance companies offering Medicare Supplements vary vastly. The original Medicare has a good alternative which is the Medicare Advantage. March 16, 2018. What Are the Benefits of Medigap? Benefits of Medicare Supplemental Insurance. Which may not be secured by a ...
College Textbooks:Helping you save money!!!!!
Thank you for visiting. Select an area of interest from the pull down menu. Choose Your Area of Interest.
Keeping iT Christmas
New Facebook Widget 1. A website created by GoDaddy’s Website Builder.
2xu Clothing Cheap Outlet - Clearance Prices - Enjoy Great Discount In 2xu USA
0 Item(s) - $0.00. Bags And Belly Bags. T-shirts tech short sleeve. Open water swim caps. New Products For March [more]. 2xu Run Visor Caps Charcoal Men s clothing beautiful in colors,2xu compression. 2xu Run Visor Caps Flame Scarlet Men s clothing,2xu mcs,outlet boutique. 2xu Socks Low Rise Black / White Men s clothing,2xu compression sock. 2xu Tech Vent 2 Tonesinglet Tank tops Orange Men s clothing,2xu compression. 2xu Speed Backpack Backpacks Black Bags and belly,2xu backpack,Outlet Seller.
Keeping It Classic
Keeping It Classless
Keeping It Classless Perspectives On Networks, Automation, Systems, and Software Engineering. Perspectives On Networks, Automation, Systems, and Software Engineering. February 27th, 2018. Unit Testing Junos with JSNAPy. About the idea of proactively testing network infrastructure for some time. I revived and added to these ideas in my last post. In that post’s video, I lay out three types of network testing in my presentation:. February 4th, 2018. I gave a presentation at the recent Network Field Day 17.
Making Memories
Sunday, September 04, 2011. Another One Bites the Dust. AJ lost his front tooth. Now the boys both lost 3 teeth. Although I think PJ's other front tooth and maybe extra tooth are almost ready. Just in time for school pics! Monday, August 29, 2011. Wednesday, August 24, 2011. Had with their former and after school teachers did not fall on deaf ears. Friday, August 19, 2011. Thursday, August 18, 2011. It's been a long time. Is this because we live in a area that is full of biotech. We Are The Panthers.
Business-Class Web Hosting by (mt) Media Temple
Mt) Media Temple,Inc. - Web Hosting Built to Scale. This page has been generated automatically. If you are the server administrator and you feel that you have reached this page in error, then try completing the following steps. Please consult the (mt) KnowledgeBase. Articles below for more information. 1 Log in to Plesk ». 2 Make sure domain is added ». 3 Create your subscription ». View all related articles ». 24-7 Global Support - 877-578-4000. 1998-2012 (mt) Media Temple, Inc. Legal.
keepingitclassyblog.wordpress.com
keepingitclassyblog | This WordPress.com site is the cat’s pajamas
This WordPress.com site is the cat’s pajamas. Apologies, but no results were found for the requested archive. Perhaps searching will help find a related post. Create a free website or blog at WordPress.com.
keepingitclassyfindingprincecharming.wordpress.com
Keeping It Classy: Finding Prince Charming | How to keep the Christian in your crazy college life
Keeping It Classy: Finding Prince Charming. How to keep the Christian in your crazy college life. New YouTube Vlog Channel! December 30, 2015. I feel like it has been SO long since I’ve updated this, and I want to tell you why! Lately, life has been really good and I’ve wanted to document it in more of an exciting way than just words on a screen-so I’ve started a YouTube channel! Posted in A Little Life Story. August 21, 2015. Posted in A Little Life Story. 1989 WORLD TOUR LOUISVILLE VIDEO BLOG. So yes, ...
keepingitclassyincoastalalabama.blogspot.com
Keeping It Classy In Coastal Alabama
Keeping It Classy In Coastal Alabama. Where We Be Gettin' All Crazy With All Things Coastal! There was an error in this gadget. Wednesday, March 28, 2012. I Have Disappeared Into The Dark Hole Of Nursing School. But I Will Be Back Soon. I am in my final semester of Nursing School, which is Critical Care Nursing, and this summer I will begin my Preceptorship and graduate in August. I have sooooo much to write about and adventures to share. I have really missed blogging a lot! Links to this post. Place the...
SOCIAL ENGAGEMENT