lemondropvintage.blogspot.com
Lemondrop VintageThis page has moved to a new address.
http://lemondropvintage.blogspot.com/
This page has moved to a new address.
http://lemondropvintage.blogspot.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Sunday
LOAD TIME
0.2 seconds
16x16
32x32
64x64
128x128
160x160
192x192
PAGES IN
THIS WEBSITE
0
SSL
EXTERNAL LINKS
201
SITE IP
172.217.9.225
LOAD TIME
0.228 sec
SCORE
6.2
Lemondrop Vintage | lemondropvintage.blogspot.com Reviews
https://lemondropvintage.blogspot.com
This page has moved to a new address.
Circle of Clothes: Stage blacks, loss, and comfort
http://circleofclothes.blogspot.com/2010/03/stage-blacks.html
Contributing to the global community of fashion bloggers in my own little way: presenting outfits that made me feel fabulous; documenting the processes and results of clothing refashions; participating in fashion bloggers' challenges and contests; showcasing items I built or purchased for others; offering a narrow window into the life of one designer and builder of theatrical costumes; and sharing whatever else I feel like sharing. Sunday, March 14, 2010. Stage blacks, loss, and comfort. I wrote earlier ...
FutureLint (I have nothing to wear!): Fin.
http://futurelint.blogspot.com/2015/05/fin.html
I have nothing to wear! Ok, not really. I have EVERYTHING to wear.). What's this all about now? The Roof is on Fire (Vintage Home). Wednesday, May 13, 2015. Ve been meaning to write this for months, but the more time that went by, the less motivated I was to actually do it. It just seemed like an insurmountable obstacle to say. I think I'm done blogging. I had a great time here for years. And I needed it. Psst, I can't post without some photos so here's a few shots of our renovations:. We juuuuuuust fini...
FutureLint (I have nothing to wear!): August 2014
http://futurelint.blogspot.com/2014_08_01_archive.html
I have nothing to wear! Ok, not really. I have EVERYTHING to wear.). What's this all about now? The Roof is on Fire (Vintage Home). Sunday, August 17, 2014. Nate and I bought a house and close on it in less than a week. Fare thee well condo! I lived here alone for 8 years and for almost a year with Nate. It's time to move it on up from 850 square feet to about 1950 feet. Whoop, whoop! Dancing with another one of my grandpas at my cousin Bryan's wedding:. Henrik cheers-ing Nate at that wedding:. Well, tha...
FutureLint (I have nothing to wear!): May 2014
http://futurelint.blogspot.com/2014_05_01_archive.html
I have nothing to wear! Ok, not really. I have EVERYTHING to wear.). What's this all about now? The Roof is on Fire (Vintage Home). Thursday, May 22, 2014. Whoa dudes, I fell way behind with the six year wrap-up and randomly playing hooky from work - so here we go. A classic photo dump. This day was super rainy, which meant I didn't bike to work so I wore a maxi skirt - generally a biking no-no. It rained for like 24 hours straight. It made me want to stay home and nap but I didn't. Cardigan - Old Navy.
FutureLint (I have nothing to wear!): April 2013
http://futurelint.blogspot.com/2013_04_01_archive.html
I have nothing to wear! Ok, not really. I have EVERYTHING to wear.). What's this all about now? The Roof is on Fire (Vintage Home). Tuesday, April 30, 2013. I found this crazy novelty print skirt at a thrift store like two months ago but didn't want to wear it until I could rock it with bare legs. I just feel like it's so insane on it's own, I didn't want to complicate it further by wearing it with tights. Necklace - vintage (my mom found it for me at a garage sale! Skirt - thrifted vintage. With Nate...
FutureLint (I have nothing to wear!): July 2013
http://futurelint.blogspot.com/2013_07_01_archive.html
I have nothing to wear! Ok, not really. I have EVERYTHING to wear.). What's this all about now? The Roof is on Fire (Vintage Home). Thursday, July 18, 2013. Wellllllll, that was a month long. My summer so far! Nate turned 30. I'm no longer a cougar. :( He also quit smoking cold turkey over two weeks ago and so far has been doing great! We went to a Twins vs. Yankees game on July 3rd. Baseball and fireworks, FTW! And we got tickets for only $5! Polo - thrifted Nike. Polo - from my last job at a golf course.
FutureLint (I have nothing to wear!): F for Effort
http://futurelint.blogspot.com/2014/05/f-for-effort.html
I have nothing to wear! Ok, not really. I have EVERYTHING to wear.). What's this all about now? The Roof is on Fire (Vintage Home). Thursday, May 22, 2014. Whoa dudes, I fell way behind with the six year wrap-up and randomly playing hooky from work - so here we go. A classic photo dump. This day was super rainy, which meant I didn't bike to work so I wore a maxi skirt - generally a biking no-no. It rained for like 24 hours straight. It made me want to stay home and nap but I didn't. Cardigan - Old Navy.
FutureLint (I have nothing to wear!): May 2015
http://futurelint.blogspot.com/2015_05_01_archive.html
I have nothing to wear! Ok, not really. I have EVERYTHING to wear.). What's this all about now? The Roof is on Fire (Vintage Home). Wednesday, May 13, 2015. Ve been meaning to write this for months, but the more time that went by, the less motivated I was to actually do it. It just seemed like an insurmountable obstacle to say. I think I'm done blogging. I had a great time here for years. And I needed it. Psst, I can't post without some photos so here's a few shots of our renovations:. We juuuuuuust fini...
franklyspeakingvintagegreetings.blogspot.com
Frankly Speaking Modern Vintage Blogspot: November 2010
http://franklyspeakingvintagegreetings.blogspot.com/2010_11_01_archive.html
Remixing, remaking, and recycling great vintage imagery. Monday, November 22, 2010. Although no one knows for sure when a camera-type device was first discovered, the. Became popular among R. Artists who used it to trace the image projected by light shining through a tiny hole. The year the invention of the photographic process was made public. That picture, captured on a silver-coated sheet of copper, using his ' positive image. The word photography was first used in the year 1839. By the time the detai...
franklyspeakingvintagegreetings.blogspot.com
Frankly Speaking Modern Vintage Blogspot: September 2010
http://franklyspeakingvintagegreetings.blogspot.com/2010_09_01_archive.html
Remixing, remaking, and recycling great vintage imagery. Saturday, September 25, 2010. These might make you think. I believe in equality for everyone, except reporters and. People are pretty much alike. It's only that our differences are more susceptible to definition than our similarities. All the people like us are we, and everyone else is They. Tell the children the truth. Is the acceptance or promotion of multiple ethnic. Links to this post. Friday, September 24, 2010. Do I really care? I just love t...
TOTAL LINKS TO THIS WEBSITE
201
Lemon Drop Team
Sweet : wedding day management. Sweeter : dessert table design. Sweetest : a combination of both. Ada and Phung's Mass Horticultural Society Wedding. Ada and Phung celebrated their elegant wedding this past August at The Massachusetts Horticultural Society Gardens at Elm Bank in Wellesley, MA. I think it's safe to say I've fallen in love with A&P's wedding and looking back at these pictures taken by the talented Kris Rae Photography reminded me how much fun we had coordinating it. Dessert : Flour Bakery.
www.lemondroptits.com coming soon!
This domain is parked free, courtesy of. Is this your domain? Add hosting, email and more. Enter a domain name:. Complete creative packages from $2.25/month! Choose the plan that's right for you! Starting at just $29.95/yr! Use of this Site is subject to express Terms of Use. By using this Site, you signify that you agree to be bound by these Terms of Use. Which were last revised on.
LD Headquarters
Lemondrop Virtual Assistance | Supporting your success
What services can you outsource? Want to know more about Jessica? Contact me to get started today! Every business owner needs effective administrative support. Do you fit into one or more of the following categories? Your administrative needs don’t justify the investment of an employee. You don’t have available office space or equipment for an assistant. You need a full-time assistant but can’t afford to pay salary benefits. Today to find out how I can help you succeed in your business!
Lemondrop Vegan
Friday, March 2, 2012. Don't End Up a Junk Food Vegan! The benefits of following a plant-based diet are almost endless; treating diabetes. Reversing heart disease, increasing the body's natural energy. . .you get the gist. However, each of those benefits doesn't come without a little effort and research on our part. Of illnesses and decreased fatigue. Oy. It gives those following a plant-based diet a bad rep! NO FAIR" I shout! I have picked items from three (Vitamins, Minerals and Water) of the six essen...
Lemondrop Vintage — a daybook
How to take care of vintage items. August 31, 2015. This is especially true when it comes to vintage clothes, as the years would have undoubtedly affected the integrity of the fabric of the items. There are many factors that could affect the quality of your item, as even exposure to direct sunlight. Could end up fading the patterns on your clothes. Taking care of your items shouldn’t be that hard, however, and I have some tips for you. A general tip, however, is to avoid washing vintage goods. Snapping b...
lemonDropXX - DeviantArt
Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')" class="mi". Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')". Join DeviantArt for FREE. Forgot Password or Username? Deviant for 4 Years. This deviant's full pageview. Last Visit: 134 weeks ago. This is the place where you can personalize your profile! You mus...
Lemondrop Yoga
Be free. Dream. Play. Open your heart, awaken your mind, challenge your body.
lemondrug (justinio) - DeviantArt
Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')" class="mi". Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')". Join DeviantArt for FREE. Forgot Password or Username? Deviant for 8 Years. This deviant's full pageview. Last Visit: 88 weeks ago. This is the place where you can personalize your profile! Thanks f...
