stephaniefierman.com
Stephanie Fierman - Marketing MojoMarketing guru Stephanie Fierman blogs on business and marketing trends
http://www.stephaniefierman.com/
Marketing guru Stephanie Fierman blogs on business and marketing trends
http://www.stephaniefierman.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Monday
LOAD TIME
7.1 seconds
Stephanie Fierman
7 Castl●●●●●●●e Drive
East●●●●over , New Jersey, 07006
United States
View this contact
Stephanie Fierman
7 Castl●●●●●●●e Drive
East●●●●over , New Jersey, 07006
United States
View this contact
Stephanie Fierman
7 Castl●●●●●●●e Drive
East●●●●over , New Jersey, 07006
United States
View this contact
BUY YOUR DOMAIN
17
YEARS
1
MONTHS
0
DAYS
GODADDY.COM, LLC
WHOIS : whois.godaddy.com
REFERRED : http://registrar.godaddy.com
PAGES IN
THIS WEBSITE
20
SSL
EXTERNAL LINKS
63
SITE IP
68.178.254.106
LOAD TIME
7.125 sec
SCORE
6.2
Stephanie Fierman - Marketing Mojo | stephaniefierman.com Reviews
https://stephaniefierman.com
Marketing guru Stephanie Fierman blogs on business and marketing trends
stephaniefierman.com
Stephanie Fierman - Marketing Mojo
http://stephaniefierman.com/stephanie-fierman-marketing-needs-customer-service.php
Building successful businesses and brands – one customer interaction at a time. Stephanie Fierman On Why Marketers (Should) Worship Customer Service. March 9th, 2008. I can’t believe I haven’t written about Mona Shaw. I had my own experience with one of these companies in the past week Time Warner Cable and once again I was reminded that all the marketing in the universe cannot make up for one customer service representative who treats me like I just fell off the turnip truck. How can one person in a cal...
Stephanie Fierman - Marketing Mojo
http://stephaniefierman.com/category/internet
Building successful businesses and brands – one customer interaction at a time. The evolution of your digital brand: from creating it to erasing it? March 17th, 2015. Anyone who knows me well knows that helping people understand, grow and protect their personal brands online is something I’ve been committed to for some time. I’ve written numerous posts on the subject, including these two recent ones – Thinking it won’t happen to you? And Don’t let social make you stupid. Where do you live? The answer is ...
Stephanie Fierman - Marketing Mojo
http://stephaniefierman.com/brands-must-protect-weaknesses-stephanie-fierman.php
Building successful businesses and brands – one customer interaction at a time. Thinking It Won’t Happen To You? November 12th, 2012. From a chair in the marketing department, it’s too easy to look only at the world that, well, you can actually see. The problem is that while your optics on other parts of the company may be zero those other zones may be your greatest weakness. And they’re operating in the webosphere 24/7. You know, for example, that your company has plants in the Far East. Tick, tick, tick.
Stephanie Fierman - Marketing Mojo
http://stephaniefierman.com/category/department-stores
Building successful businesses and brands – one customer interaction at a time. Ever Wish It Was Christmas Every Day Of The Year? December 2nd, 2013. If you’re not careful, you may get your wish. Readers know that I’m partial to a couple cartoonists and like to share their work now and then. On my second blog, it’s David Jones‘ Adland. Here, it’s Tom Fishburne’s Marketoonist. Posted by Stephanie Fierman. DNA Sample, Please. April 11th, 2011. A couple days ago, I returned a dress to Kenneth Cole. 8216;Tur...
Stephanie Fierman - Marketing Mojo
http://stephaniefierman.com/category/advertising
Building successful businesses and brands – one customer interaction at a time. Ever Wish It Was Christmas Every Day Of The Year? December 2nd, 2013. If you’re not careful, you may get your wish. Readers know that I’m partial to a couple cartoonists and like to share their work now and then. On my second blog, it’s David Jones‘ Adland. Here, it’s Tom Fishburne’s Marketoonist. Posted by Stephanie Fierman. Where The Wild Things Are In Marketing. May 14th, 2012. Here, it’s Tom Fishburne. October 25th, 2011.
TOTAL PAGES IN THIS WEBSITE
20
reputation-dynamics.blogspot.com
Conscious Commerce: Reputation Dynamics forms Partnership with Climb the Green Ladder: Sustainability Training Critical for Retaining Talent and Competitive Edge
http://reputation-dynamics.blogspot.com/2009/09/corporate-responsibility-training-at.html
Aligning Society's Interests with Competitive Business Edge' created by Samantha Taylor - Founder of Reputation Dynamics - a for and not-for-profit social change marketing, sustainability development and training services consultancy. We help properly align and market stakeholder-driven initiatives with business impact. Key issues span healthcare (HIV/AIDS), poverty, environment, workplace development and youth education. MEMBER OF THE UN GLOBAL COMPACT. Sunday, November 8, 2009. Climb the Green Ladder.
reputation-dynamics.blogspot.com
Conscious Commerce: Jan 18, 2010
http://reputation-dynamics.blogspot.com/2010_01_18_archive.html
Aligning Society's Interests with Competitive Business Edge' created by Samantha Taylor - Founder of Reputation Dynamics - a for and not-for-profit social change marketing, sustainability development and training services consultancy. We help properly align and market stakeholder-driven initiatives with business impact. Key issues span healthcare (HIV/AIDS), poverty, environment, workplace development and youth education. MEMBER OF THE UN GLOBAL COMPACT. Monday, January 18, 2010. View my complete profile.
reputation-dynamics.blogspot.com
Conscious Commerce: Nov 8, 2009
http://reputation-dynamics.blogspot.com/2009_11_08_archive.html
Aligning Society's Interests with Competitive Business Edge' created by Samantha Taylor - Founder of Reputation Dynamics - a for and not-for-profit social change marketing, sustainability development and training services consultancy. We help properly align and market stakeholder-driven initiatives with business impact. Key issues span healthcare (HIV/AIDS), poverty, environment, workplace development and youth education. MEMBER OF THE UN GLOBAL COMPACT. Sunday, November 8, 2009. Climb the Green Ladder.
reputation-dynamics.blogspot.com
Conscious Commerce: Oct 9, 2009
http://reputation-dynamics.blogspot.com/2009_10_09_archive.html
Aligning Society's Interests with Competitive Business Edge' created by Samantha Taylor - Founder of Reputation Dynamics - a for and not-for-profit social change marketing, sustainability development and training services consultancy. We help properly align and market stakeholder-driven initiatives with business impact. Key issues span healthcare (HIV/AIDS), poverty, environment, workplace development and youth education. MEMBER OF THE UN GLOBAL COMPACT. Friday, October 9, 2009. Of Fortune 500 companies,...
reputation-dynamics.blogspot.com
Conscious Commerce: Live from The Corporate Council on Africa - Perspectives on Aligning Social Responsibility for Africa
http://reputation-dynamics.blogspot.com/2009/10/live-from-corporate-council-on-africa.html
Aligning Society's Interests with Competitive Business Edge' created by Samantha Taylor - Founder of Reputation Dynamics - a for and not-for-profit social change marketing, sustainability development and training services consultancy. We help properly align and market stakeholder-driven initiatives with business impact. Key issues span healthcare (HIV/AIDS), poverty, environment, workplace development and youth education. MEMBER OF THE UN GLOBAL COMPACT. Friday, October 9, 2009. Of Fortune 500 companies,...
reputation-dynamics.blogspot.com
Conscious Commerce: Jul 30, 2009
http://reputation-dynamics.blogspot.com/2009_07_30_archive.html
Aligning Society's Interests with Competitive Business Edge' created by Samantha Taylor - Founder of Reputation Dynamics - a for and not-for-profit social change marketing, sustainability development and training services consultancy. We help properly align and market stakeholder-driven initiatives with business impact. Key issues span healthcare (HIV/AIDS), poverty, environment, workplace development and youth education. MEMBER OF THE UN GLOBAL COMPACT. Thursday, July 30, 2009. So You Think You Can Dance.
infocontentstrategies.typepad.com
InfoInnovation
http://infocontentstrategies.typepad.com/infoinnovation
Occasional commentary on the transformation of the information content industry. Subscribe in a reader. Enter your email address:. See how we're connected. Holding On to a Dream. Science Publishers Stepping Up Online Community Initiatives. Alacra's new Pulse platform: mining expert opinion on the real-time Web. Blodget's synthesis: an evolutionary view of online news brands and business models. Business models for online news - thesis/antithesis. More signs of B2B integration of social media. Information...
stephaniefiermanmarketingdaily.com
Stephanie Fierman - Marketing Observations Grown Daily
http://www.stephaniefiermanmarketingdaily.com/category/women-online
Stephanie Fierman – Marketing Observations Grown Daily. Ron Shevlin's Snarketing. And on to a new year. Tuesday December 31st 2013, 4:19 pm. Filed under: stephanie fierman. So I was in a hospital yesterday with my mom (because holidays and hospitals: that’s just how I roll) and I thought one of her doctors was cute. I was trying to be entertaining, so I said to my mom, “Hey, who knows? Maybe I’ll make my dead grandmothers happy, and still end up with a rich DOC-tuh! Well played, grandmothers, well played.
stephaniefiermanmarketingdaily.com
Stephanie Fierman - Marketing Observations Grown Daily
http://www.stephaniefiermanmarketingdaily.com/category/advertising
Stephanie Fierman – Marketing Observations Grown Daily. Ron Shevlin's Snarketing. Any is too many, Chevrolet. Tuesday April 14th 2015, 10:59 am. If you’d asked me if I could be surprised by any dumb decisions made by GM in the last few years (aside from borrowing money from taxpayers), I’d have said no… ’til now. The perils of texting while driving (TWD) are widely known. In the U.S. alone, TWD creates a crash risk 23 times. So I suppose Chevrolet decided. If you cannot view the ad below, see it HERE.
TOTAL LINKS TO THIS WEBSITE
63
Stephanie Fieger - There's No Place Like...
There's No Place Like. Three reasons to be an actor: you don't want to work, you don't want to get up early, and you're afraid to steal.". Broadway Debut, y'all. And it was awesome. Stephanie as Harpier (and a slew of other fun ladies). The Fall of 2013 at. Guess who was on the cover of April 2013's. Yup, this guy. Stephanie as Hedda Gabs. A lean, mean, hour-long. Staged reading of our favorite general's daughter. April 8 @ 3PM. April 9 @ 11:10AM. April 11 @ 3 and 6PM. Directed by Christopher Scott.
Stephanie Fieger Klein
Skip to main content. Get Your Free Nutrition Book Excerpt! Get Your Free Nutrition Book Excerpt! The first two chapters of this book are a great introduction to the coaching approach I use with my clients. There is no one-size-fits-all diet discover what works for YOU! Learn how to nourish your body and create the life that you've been dreaming of by downloading the first two digital chapters copy of. Integrative Nutrition: Feed Your Hunger for Health and Happiness. Leave this field blank. It’s rare for...
stephaniefieldberg.blogspot.com
Stephanie Fieldberg Photography
Saturday, July 26, 2014. Medalta Potteries : Medicine Hat Wedding Photography : Stef and Dane. Subscribe to: Posts (Atom). Medalta Potteries : Medicine Hat Wedding Photograp. Medicine Hat Wedding Photography : Ranch Style Wed. Elkwater Lake Lodge Wedding Venue - Elkwater and Med. Medalta Potteries Wedding Venue - Medicine Hat Wed.
Wedding_Photography_Medicine_Hat_Lethbridge_Index
Stephanie Field Photography | Waterloo,ON
Stephanie Fierman - Marketing Mojo
Building successful businesses and brands – one customer interaction at a time. The evolution of your digital brand: from creating it to erasing it? March 17th, 2015. Anyone who knows me well knows that helping people understand, grow and protect their personal brands online is something I’ve been committed to for some time. I’ve written numerous posts on the subject, including these two recent ones – Thinking it won’t happen to you? And Don’t let social make you stupid. Where do you live? The answer is ...
stephaniefiermanmarketingdaily.blogspot.com
Stephanie Fierman - Marketing Observations Grown Daily
Stephanie Fierman - Marketing Observations Grown Daily. Business guru Stephanie Fierman offers daily observations on the worlds of marketing and consumerism. Marketing Observations Grown Daily now has its own home: www.stephaniefiermanmarketingdaily.com/. We'll expect to see you there soon! And thanks for reading. Subscribe to: Posts (Atom). View my complete profile. Jarvis Cromwell - Reputation Garage. Paul Dunay - Buzz Mktg For Tech. Stephanie Fierman - Marketing Mojo. Stephanie Fierman On Squidoo.
stephaniefiermanmarketingdaily.com
Stephanie Fierman - Marketing Observations Grown Daily
Stephanie Fierman – Marketing Observations Grown Daily. Ron Shevlin's Snarketing. Any is too many, Chevrolet. Tuesday April 14th 2015, 10:59 am. If you’d asked me if I could be surprised by any dumb decisions made by GM in the last few years (aside from borrowing money from taxpayers), I’d have said no… ’til now. The perils of texting while driving (TWD) are widely known. In the U.S. alone, TWD creates a crash risk 23 times. So I suppose Chevrolet decided. If you cannot view the ad below, see it HERE.
Stephanie Figueira - Actor . Presenter . Voice Artist
Actor . Presenter . Voice Artist. 34 634 195 999. 2013 Stand up Comedy. Winner of the 2013 International Stand Up Competition in Spain. Barcelona Improv Group performs monthly English-language improvised comedy shows in Barcelona. A Canadian business woman, an English hipster artist and an Italian teacher and dreamer decide to open a residency for artists in sunny Barcelona. Apokalipstik - Working title. Esoteric gangster comedy world premiere at Sitges international film festival 2014.
stephaniefigueroa.com
美容外科で気になるしわやたるみを取ってもらう
SOCIAL ENGAGEMENT