thehappyhealthcounselor.com
The Happy Health Counselor
Skip to main content. Every human being is the author of his own health or disease. Learn the secrets to healthy living. Eat right, live well. When was the last time you talked with someone about your health and received the personal attention you deserve? It’s rare for anyone to get an hour to work on their nutrition and goals with a trained professional. No one diet works for everyone. Could one conversation change your life? Support is just a phone call or email away! Create A Great Day!
thehappyhealthfreak.com
The Happy Health Freak -
The Happy Health Freak. Meatless Monday / Vegetarian Meals. Soups, Salads & Sides. Health & Wellness Tips. Detox & Cleanses. 3-Day Dr. Oz Detox Cleanse. 3-Day Joe Cross Juice Cleanse. 30 Day Paleo Challenge. Summer Citrus Bean Salad. August 13, 2015. Nothing beats fresh summer veggies straight from the garden. Beans are one of the easiest things to grow (take it from someone who does not have a green thumb! This year, my beans exploded in our garden and I had … Continue reading →. Soup, Salads and Sides.
thehappyhealthy.blogspot.com
Essential Oils in Daily Use
Essential Oils in Daily Use. Aromatherapy Tips - The benefits of Essential Oils for daily usages - Essential Oils for health and beauty. Thursday, June 21, 2007. Aromatherapy: Learn about it … create it … enjoy it - includes recipes. On the following pages are some everyday aromatherapies for some common problems:. Hair and scalp problems. Facial lotions, creams and toners. Sensitive skin responds well to rose and neroli, which are anti-inflammatory, while sandalwood and cypress help to treat broken veins.
thehappyhealthybalance.com
THE HAPPY, HEALTHY BALANCE
THE HAPPY, HEALTHY BALANCE. WHAT IS A HEALTH WELLNESS COACH? TIPS FOR IMPROVING WELLNESS IN THE WORKPLACE. August 13, 2015. Good morning, friends! I hope this day is treating you well! Today I want to talk to you about wellness at work. How many of you find that while you are working, you feel sleepy, stiff, or even cranky? Possibly craving a cup of coffee or a piece of chocolate around 3PM? TIPS FOR IMPROVING WELLNESS IN THE WORKPLACE. Get some fresh air. Almost always, right? What your body is craving)...
thehappyhealthyblog.wordpress.com
The Happy & Healthy Blog | Just trying to be healthy in an unhealthy world
The Happy and Healthy Blog. Just trying to be healthy in an unhealthy world. 1 can of full fat coconut milk. 1 cup decaf coffee (cool or room temp. ). 1/4 cup cacao nibs. 1 packet of stevia. Mix all the ingredients together in a blender. Then pour in a Popsicle mold, freeze and enjoy. Paleo Shepherd’s Pie. I’ve made this a couple different times and each time it’s been different. However, tonight’s version is by far my favorite. It was super easy and quick to fix for the family. 1 lb grass fed ground beef.
thehappyhealthycat.com
The Happy Healthy Cat
The Happy Healthy Cat. Thursday, January 31, 2013. This site is under construction. Please check back again soon! The Happy Healthy Cat. Subscribe to: Posts (Atom). This site is under construction. Please check bac. The Happy Healthy Cat. View my complete profile. Simple template. Powered by Blogger.
thehappyhealthychicken.com
The Happy Healthy Chicken - Home
The Happy Healthy Chicken. Like us on Facebook! Scratch and Peck Feed Q and A. Other Feed and Products. The Problems With Soy. Fun with a Broody Hen! Chickens After The Rain. Chicken Illness and Other Hazzards. Lavender and Buff Orpingtons. We're glad you stopped by for a visit. We are located in the Inland Empire in Southern California and are ready to meet your organic chicken feed. If you are in the High Desert/Apple Valley region of Southern California please visit Healing Throughout.
thehappyhealthygirl.wordpress.com
thehappyhealthygirl
Pink smoothies have taken a back seat for the last couple of morning in favour of pink oats! It started last week when I didn’t have enough frozen raspberries on hand to make a decent smoothie so instead I just cooked them straight into bowl of porridge made with soya milk. The raspberries went all mushy and made my breakfast look so pretty! I’m still trying to eat high protein meals! 43g of protein for the whole meal and my first real attempt at poaching an egg! What did you eat for Sunday dinner? If yo...
thehappyhealthyheavenlylifestyle.wordpress.com
TheHappy, TheHealthy & TheHeavenly | Happy body+Healthy soul+Heavenly mind= Succesful life
TheHappy, TheHealthy and TheHeavenly. Happy body Healthy soul Heavenly mind= Succesful life. What’s the 3 “Hs” all about? 16 septiembre, 2014. Hey beautiful people with gorgeous souls! The one reading this! Thank you for your interest on checking my blog and taking time and energy to read it through! It’s been a wonderful and crazy journey (in a good way this last 2 years! And how Faith met Fitness and became the best friends everrrr! Is the perfect time! Anyways, I live in Spain and grew up here within ...