thehappyhealthygirl.wordpress.com
thehappyhealthygirl
Pink smoothies have taken a back seat for the last couple of morning in favour of pink oats! It started last week when I didn’t have enough frozen raspberries on hand to make a decent smoothie so instead I just cooked them straight into bowl of porridge made with soya milk. The raspberries went all mushy and made my breakfast look so pretty! I’m still trying to eat high protein meals! 43g of protein for the whole meal and my first real attempt at poaching an egg! What did you eat for Sunday dinner? If yo...
thehappyhealthyheavenlylifestyle.wordpress.com
TheHappy, TheHealthy & TheHeavenly | Happy body+Healthy soul+Heavenly mind= Succesful life
TheHappy, TheHealthy and TheHeavenly. Happy body Healthy soul Heavenly mind= Succesful life. What’s the 3 “Hs” all about? 16 septiembre, 2014. Hey beautiful people with gorgeous souls! The one reading this! Thank you for your interest on checking my blog and taking time and energy to read it through! It’s been a wonderful and crazy journey (in a good way this last 2 years! And how Faith met Fitness and became the best friends everrrr! Is the perfect time! Anyways, I live in Spain and grew up here within ...
thehappyhealthyhippie.com
Happy.Healthy.Hippie
Tip of the week. August 10, 2015. LOVE life and life will love you back! Spreadthelovepb #ilovewhatido #momtrepreneur ❤️❤️❤️ (at West Elm Santa Monica). August 03, 2015. My current 12-inch of heaven. My pregnant self can easily finish this baby. #Banhmi #foodporn #vietnamese. July 31, 2015. The perfect night to meditate under the moonlight. 🌑 #bluemoon #findyourself #yoga. July 28, 2015. Thank you #Wisconsin for the beautiful weather and family love! We are now back home in LALA! July 24, 2015. Woohoo&h...
thehappyhealthyhippy.com
happyhealthyhippy | Home-made VEGAN recipes [made with love]
Home-made VEGAN recipes [made with love]. Gluten-free Cauliflower Potato Bites. Sloppy Jane Grilled a Cheese. Things you will need. 8 oz of tofu (firm tofu, I used sprouted). 1/3 cup of mylk. 3 tbsp of nutritional yeast. 1 tbsp of cornstarch. 1 tbsp of all-purpose gluten-free flour (I use Bob Mills). 1/4 tsp of salt. 1/8 tsp of turmeric. Pinch of cayenne pepper (optional). Leave a Reply Cancel reply. Your email address will not be published. Required fields are marked *. You may use these.
thehappyhealthyhome.blogspot.com
Happy Healthy Home
Thursday, January 30, 2014. Quick and Easy Spanish Rice. Happy Healthy Home's Spanish Rice. 2 tbsp. butter. 1 onion chopped (about 1 cup give or take). 2 tsp minced garlic. 2 cups white or brown rice. 2 1/2 cups water or chicken broth (if no broth add in 2 tsp. "Better than Bouillion" chicken). 1 cup tomato sauce. 4 tbsp. (or so) parsley. Next add the uncooked rice. Let it get golden brown in the pan, tossing occasionally. Links to this post. Tuesday, December 3, 2013. Homemade Canned soup ingredients:.
thehappyhealthyhome.com
The Happy Healthy Home | A Fresh way or organize your HEALTH your HOME and your HAPPINESSThe Happy Healthy Home | A Fresh way or organize your HEALTH your HOME and your HAPPINESS
The Happy Healthy Home A Fresh way or organize your HEALTH your HOME and your HAPPINESSThe Happy Healthy Home A Fresh way or organize your HEALTH your HOME and your HAPPINESS. Do you want search? Home of the BRAVE. As we have been preparing to take our boys to Europe for a couple weeks, the thought of leaving my girls is making my heart hurt a little. As dorky as it sounds, my favorite thing in the whole world is being with my family! They are who I want to play with, and […]. July 30, 2015. July 28, 2015.
thehappyhealthyhotmess.com
thehappyhealthyhotmess
Skip to main content. Skip to secondary content. Sorry, but nothing matched your search criteria. The Hot Mess Soundtrack. Blog at WordPress.com. Blog at WordPress.com. Follow “thehappyhealthyhotmess”. Get every new post delivered to your Inbox. Build a website with WordPress.com. Add your thoughts here. (optional).
thehappyhealthyhousewife.com
The Happy Healthy Housewife - Helping you help yourself. - Happy Healthy Blog
The Happy Healthy Housewife - Helping you help yourself. Eat Bananas.if you know what's good for you. 2 cups baby spinach. 2 cups frozen mangos, peaches and or strawberries. 1 tbsp flax meal. 1 tbsp Lecithin granules. ( vegan). 1 cup almond milk. This makes 2 large smoothies with a total of 5 servings of your daily (5-8) fruit and vegetables. These smoothies are great for anyone with Alzheimers disease, high cholesterol. Beet Salad - Gerson Therapy Recipes for a longer life. Or Garlic and Onion Dressing.
thehappyhealthylesbian.com
The Happy Healthy Lesbian - Home
The Happy Healthy Lesbian. Free training: Discover the 3 Big Barriers that are holding you back. Sick of trying to make changes in your life that just don't stick? You'll LOVE this new webinar! Join me for a juicy discussion where I'll reveal the three most common reasons why your efforts to change in the past haven't stuck. In this call you will:. Discover why your past attempts to change your diet, wellness, self care and self-nurturing behaviours have failed. Register for this great call right here:.
