livesimplylive.blogspot.com
live simply and simply liveto live the life i love, love the life i live
http://livesimplylive.blogspot.com/
to live the life i love, love the life i live
http://livesimplylive.blogspot.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Tuesday
LOAD TIME
0.4 seconds
PAGES IN
THIS WEBSITE
10
SSL
EXTERNAL LINKS
111
SITE IP
172.217.12.161
LOAD TIME
0.403 sec
SCORE
6.2
live simply and simply live | livesimplylive.blogspot.com Reviews
https://livesimplylive.blogspot.com
to live the life i love, love the life i live
live simply and simply live: Scarlett's Birth Story
http://livesimplylive.blogspot.com/2014/05/scarletts-birth-story.html
Thursday, May 08, 2014. Preface to Scarlett's birth story:. Now for the birth story. I made blt's for dinner and afterwards I put Barney on for Hazel to watch before bed. I sat down to watch Barney with her and was feeling really down. I was really discouraged I hadn't gone in to labor yet and was frustrated thinking I would have to be induced. (TMI alert)! Four pushes was all it took. It was so fast and easy and wonderful. I felt so blessed because my epidural was weak enough that I was able to ...
live simply and simply live: Christmas 2014
http://livesimplylive.blogspot.com/2014/12/christmas-2014.html
Saturday, December 27, 2014. Christmas was pretty perfect. Hazel is now at the age where she gets what is going on and Scarlett is at the stage of great exploration. They both thoroughly enjoyed Christmas morning and I enjoyed seeing them both have smiles on their faces all day long. Santa brought Hazel a rocking horse. They took turns and played on that rocking horse all day long and the first thing Hazel did when she woke up the next morning was get on that horse. I would say it was a success!
live simply and simply live: obligatory apology for blogging absence
http://livesimplylive.blogspot.com/2014/05/obligatory-apology-for-blogging-absence.html
Tuesday, May 06, 2014. Obligatory apology for blogging absence. In the past {almost} year since i last blogged we have not only added a new member to our family but we have relocated to washington. i would say these major life changes excuse my blogging absence, right? 6 lbs 14 oz 20 1/2 inches. Created by kira lee. Subscribe to: Post Comments (Atom). Kira is just your average not-so-average girl trying to figure out where life will take her next while enjoying the adventures along the way. A cup of jo.
live simply and simply live: bathroom talk
http://livesimplylive.blogspot.com/2013/03/bathroom-talk.html
Thursday, March 07, 2013. Created by kira lee. Subscribe to: Post Comments (Atom). Kira is just your average not-so-average girl trying to figure out where life will take her next while enjoying the adventures along the way. View my complete profile. A cup of jo. Living the swell life. The dish on delish.
live simply and simply live: Where the heart is
http://livesimplylive.blogspot.com/2014/08/with-david-working-six-days-week-it-is.html
Wednesday, August 20, 2014. Where the heart is. Created by kira lee. Labels: chaotic family togetherness. Your family is so cute! Subscribe to: Post Comments (Atom). Kira is just your average not-so-average girl trying to figure out where life will take her next while enjoying the adventures along the way. View my complete profile. A cup of jo. Living the swell life. The dish on delish.
TOTAL PAGES IN THIS WEBSITE
10
joy pursuit energy LIFE: GRAD and AZ!
http://lindslivinlife.blogspot.com/2009/04/grad-and-az.html
Joy pursuit energy LIFE. My own state of mind is the determining key, for I am only the person I let myself be. Saturday, April 18, 2009. Wow I can't believe I am finished with college. Graduation was awesome, Elder Neil Anderson. Spoke at commencement. It was really good. My. Mom and Dad were able to come down, that was. Awesome to have them. The past week has been. Crazy Two of my roommates got married the week-. End of graduation, and after their receptions, we. It was a LONG drive. We had an. This is...
Nathan & Caroline's Blog: Night Market at Keelung
http://wunianwen.blogspot.com/2011/02/night-market-at-keelung.html
Dallas, TX, United States. View my complete profile. Nathan and Carolines Blog. Night Market at Keelung. Joanne and Justin Chen. Kira's Photo a Day. Our Picasa Web Album. Sarah and Dylan Rager. Sarah's I Have Seen His Hand. Monday, February 28, 2011. Night Market at Keelung. Subscribe to: Post Comments (Atom). Nathan with Caroline's Dad - 念文跟爸爸. This picture was taken in November at the Dallas Market Center. Create your own visited country map. Or check our Venice travel guide.
joy pursuit energy LIFE: July 2009
http://lindslivinlife.blogspot.com/2009_07_01_archive.html
Joy pursuit energy LIFE. My own state of mind is the determining key, for I am only the person I let myself be. Tuesday, July 14, 2009. Utah tonight- MTC tomorrow. Morning @ 11:30 am. I am so so excited, but a little. Nervous as well. :) I want to just thank everyone for. Their love and support with my mission! Been overwhelmed by the love and support from family. And friends. Thank you so much. I'll be sending some pics. From Ukraine and my sister should be. May God bless everyone in their.
joy pursuit energy LIFE: April 2009
http://lindslivinlife.blogspot.com/2009_04_01_archive.html
Joy pursuit energy LIFE. My own state of mind is the determining key, for I am only the person I let myself be. Saturday, April 18, 2009. Wow I can't believe I am finished with college. Graduation was awesome, Elder Neil Anderson. Spoke at commencement. It was really good. My. Mom and Dad were able to come down, that was. Awesome to have them. The past week has been. Crazy Two of my roommates got married the week-. End of graduation, and after their receptions, we. It was a LONG drive. We had an. This is...
Nathan & Caroline's Blog: October 2009
http://wunianwen.blogspot.com/2009_10_01_archive.html
Dallas, TX, United States. View my complete profile. Nathan and Carolines Blog. Welcome to our family! Joanne and Justin Chen. Kira's Photo a Day. Our Picasa Web Album. Sarah and Dylan Rager. Sarah's I Have Seen His Hand. Saturday, October 31, 2009. Welcome to our family! Kaidi was born on 10/30/2009 at 2:52pm (the same birthday as her auntie Joanne). She weighs 5 lbs 5oz and is 17 inces long. She is very small but both her mommy and her are very healthy and happy. Monday, October 26, 2009.
liveyourlifecleverly.blogspot.com
LIFE......as we know it
http://liveyourlifecleverly.blogspot.com/2015/01/over-past-year-ive-struggled.html
LIFEas we know it. Friday, January 16, 2015. What am I doing wrong? Why isn't Heavenly Father answering my prayers? I finally asked my wonderful sweetheart to give me a blessing, and again I heard the same thing, that I needed to reach out. Subscribe to: Post Comments (Atom). Check out Keisha Asay Hair Design. Keisha Asay Hair Design. People we ♥. Dani and Tanner Barker. Keisha Asay Hair Design. Kim and Tyler Muir. Laverne and Tony Norton. Rebecca and Caleb Barthlome. Best day of my life.
Heidi Jo Hartley: Miercoles
http://heidijohartley.blogspot.com/2011/08/miercoles.html
Attempting to make every day an adventure. Wednesday, August 24, 2011. I can't believe its already Wednesday! But then again, I find myself saying "It's only. Monday I technically had off because of my messed up schedule last week. However, I just stayed at the Ranch because I had just returned from Escondido on Saturday and with the wait at the border, and gas, and well, what was I going to do in one day? Then later I went out for tacos with Britta (the German intern). I love me some tacos.
Heidi Jo Hartley: August 2011
http://heidijohartley.blogspot.com/2011_08_01_archive.html
Attempting to make every day an adventure. Monday, August 29, 2011. Wellwith the help of the Wright brothers and Southwest Airlines, I am currently sitting in Nampa, Idaho. Grandma left this world on Friday night and I took a little emergency trip home for the funeral. So, there will be no updates this week, but I wanted to catch up on the couple of days before leaving the Ranch. Friday, August 26, 2011. Kuchumaa (Koo-choo-ma) Gym- where I teach Zumba and they hold other dance and aerobic classes. So I s...
Heidi Jo Hartley: Polo
http://heidijohartley.blogspot.com/2011/09/polo.html
Attempting to make every day an adventure. Saturday, September 10, 2011. Friday morning I was shepherd for the Alex Oak hike (picture of me at the Oak tree below). At breakfast, I made the morning announcements over the microphone in the dining hall. Good thing I'm not microphone shy! 6 weeks down.8 weeks to go! Subscribe to: Post Comments (Atom). Picture Window template. Powered by Blogger.
joy pursuit energy LIFE: Sister Clark has been called...
http://lindslivinlife.blogspot.com/2009/02/sister-clark-has-been-called.html
Joy pursuit energy LIFE. My own state of mind is the determining key, for I am only the person I let myself be. Monday, February 23, 2009. Sister Clark has been called. I AM GOING TO UKRAINE! I have been called to serve in the Ukraine, Kyiv. I leave July 15th to the MTC in Provo. To learn the Ukrainian language. My mission is huge! It is about 800 by 700 miles and borders the Black. Sea They are building a temple in Ukraine and. They said it should be finished spring of 2010! Is where I'm supposed to be!
TOTAL LINKS TO THIS WEBSITE
111
Live Simply Horticulture
Live Simply Horticulture is not just a service to you and your loved ones. It's a way of life. Phone Lindsay @ 902.956.8570. Let us give your lawn the attention it needs. From building, planting, watering and weeding, we've got it covered! Have shrubs or trees in need of a pruning? Dead patches in your lawn? We are a registered dealer with Hannas Seeds (AB residents only). Currently working on becoming a Registered Horticulture Therapist!
livesimplyintheworld.wordpress.com
Simply Green | Living Simply, Living Green & Saving Money
Living Simply, Living Green and Saving Money. Saving Money with Organic Foods. April 26, 2010. You CAN save money and eat healthy, earth conscious foods! It’s so simple I can’t believe I didn’t think of it before! Here is the secret:. Switch to a plant-based diet. That’s it…. Apparently, and I just learned this new word last week, a flexitarian is someone who eats mostly a plant-based diet but isn’t opposed (morally or otherwise) to eating meat on the occasion. 18 lb for fresh caught wild Salmon, $7....
Live Simply Health Journals
Documenting your child’s Wellness Checks is going to be easy when using this section of the journal. The basic information given during these checks can be quickly documented while at the visit with your child’s doctor. We’ve made certain to include height, weight and even a space to write their percentile for each so you can make sure your child is on track. South Phoenix Healthy Start - Phoenix, AZ. Moonbeams - The Shops at Gainy Ranch - Scottsdale, AZ. Write Ons Etc. - Phoenix, AZ. This would make an ...
live simply | live simply. that's it.
March 20, 2014 · 6:48 pm. Yep – I’m building these. Even though our garden is well fenced, we always have interlopers. Perhaps these…. Http:/ www.grit.com/farm-and-garden/building-garden-fence-boxes.aspx#axzz2wWvo24jZ. September 14, 2013 · 2:21 pm. A wee miss calculation. Anyway, I have no shortage of things to do today. And tomorrow we’re butchering meat birds (so long as the wasps aren’t posing a problem). It will be a very full weekend. September 14, 2013 · 1:56 am. It’s still Flannelberry Friday.
live simply and simply live
Monday, June 20, 2016. Olive Miriam Asay joined our family on February 2, 2016 at 1:05 pm. She weighed 7 lbs 10 oz and was 20 inches long. If that date sounds familiar that's because it is- Olive shares a birthday with big sister, Scarlett. What was I supposed to do for 4 hours? Created by kira lee. Saturday, December 27, 2014. Created by kira lee. Labels: chaotic family togetherness. Wednesday, August 20, 2014. Where the heart is. Created by kira lee. Labels: chaotic family togetherness. On the fourth o...
livesimplylivehealthy.com
Welcome to: livesimplylivehealthy.com. This Web page is parked for FREE, courtesy of GoDaddy.com. Search for domains similar to. Is this your domain? Let's turn it into a website! Would you like to buy this. THE domain at THE price. Visit GoDaddy.com for the best values on. Restrictions apply. See website for details.
livesimplylivethriftylivesavvy.com
Live Simply, Live Thrifty, Live Savvy | Life Lived Better
Live Simply, Live Thrifty, Live Savvy. About ‘Live Simply, Live Thrifty, Live Savvy’. Awards & Accolades. Let’s Get in Touch! 3 Health Benefits of Eating Soups. I’m very excited to announce that we have a guest blog post. However, eating soup on a regular basis doesn’t just protect you from a runny nose; there are various health benefits of this tasty meal. So, clear or thick, eating soups is beneficial for your well-being and we’ve taken it upon ourselves to note these 3 major health benefits of sou...
Live Simply Love
What I Brought Into Marriage. October 24, 2013. If you’re new here, you may want to subscribe to my RSS feed. Thanks for visiting! In ancient times (and even today in some parts of the world), a bride brought a dowry usually property belonging to her parents into a marriage. The intent of a dowry was to provide future support for the bride and her children […]. My Gift to the World. October 15, 2013. Writing, Feeling God’s Pleasure and the Unintended Sabbatical. August 30, 2013. September 19, 2012. Augus...
livesimplylovedeeply.wordpress.com
:: live simply :: love deeply ::
Live simply : love deeply :. Take a walk with me. Vulnerability and enemy love. January 24, 2014. I hear echoes of the tune’s melody, and I wonder what act of love, as simple as a few notes played on a trumpet, might lift me out of anger, out of hatred, and into the fullness and grace of love.”. 8212; Mariah Heglson (Commentary on the video above). September 8, 2013. So, i’m here in Vancouver with the Servants team. Orientation is starting tomorrow. In this shared language i don’t have to have a th...
Live Simply Love Generously | Live Simply Love Generously Devotional
Live Simply Love Generously. October 22, 2012 · 4:49 am. Overview of Week 4: Life. As we continue reading through Gordon MacDonald’s book, Generosity: moving toward life that is truly life, I wanted to provide an overview of what you will learn in Week 4. 8220;See also that you excel in the grace of giving” – 2 Corinthians 8:7. God says that everyone should excel in the grace of giving. Whether poor or rich, young or old…giving is for everyone. But how often do we celebrate those who do? Excellent planni...