livesimplylivethriftylivesavvy.com
Live Simply, Live Thrifty, Live Savvy | Life Lived BetterLife Lived Better
http://www.livesimplylivethriftylivesavvy.com/
Life Lived Better
http://www.livesimplylivethriftylivesavvy.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
0.7 seconds
16x16
32x32
64x64
128x128
160x160
192x192
LIVE SIMPLY, LIVE THRIFTY, LIVE SAVVY
JENNIFER L. LOPEZ
334 ES●●●●●● DR NW
ALBU●●●●RQUE , NEW MEXICO, 87105-1956
UNITED STATES
View this contact
LIVE SIMPLY, LIVE THRIFTY, LIVE SAVVY
JENNIFER L. LOPEZ
334 ES●●●●●● DR NW
ALBU●●●●RQUE , NEW MEXICO, 87105-1956
UNITED STATES
View this contact
BLUEHOST.COM
BLUEHOST INC
1958 S●●●●●●0 EAST
PR●●VO , UTAH, 84606
UNITED STATES
View this contact
12
YEARS
10
MONTHS
18
DAYS
FASTDOMAIN, INC.
WHOIS : whois.fastdomain.com
REFERRED : http://www.fastdomain.com
PAGES IN
THIS WEBSITE
20
SSL
EXTERNAL LINKS
14
SITE IP
69.195.124.207
LOAD TIME
0.715 sec
SCORE
6.2
Live Simply, Live Thrifty, Live Savvy | Life Lived Better | livesimplylivethriftylivesavvy.com Reviews
https://livesimplylivethriftylivesavvy.com
Life Lived Better
Having a Pet Can Be Expensive– Here Are Some Cheats! | Live Simply, Live Thrifty, Live Savvy
http://livesimplylivethriftylivesavvy.com/2015/06/08/having-a-pet-can-be-expensive-here-are-some-cheats
Live Simply, Live Thrifty, Live Savvy. About ‘Live Simply, Live Thrifty, Live Savvy’. Awards & Accolades. Let’s Get in Touch! FREE 11X14 Photo Canvas from Canvas People. Exceptional Entrepreneur Series: Young Artist Molds Clay into a Successful Business →. Having a Pet Can Be Expensive Here Are Some Cheats! Guest blogger Roxana Oliver’s 2 dogs Brando and Astoria running on the beach. I’m very excited to announce that we have a guest blog post. First of all, if you are eager to adopt a pet, try your local...
Exceptional Entrepreneur Series | Live Simply, Live Thrifty, Live Savvy
http://livesimplylivethriftylivesavvy.com/category/exceptional-entrepreneur-series
Live Simply, Live Thrifty, Live Savvy. About ‘Live Simply, Live Thrifty, Live Savvy’. Awards & Accolades. Let’s Get in Touch! Category Archives: Exceptional Entrepreneur Series. Exceptional Entrepreneur Series: Young Artist Molds Clay into a Successful Business. Read how this young 20-something New Mexican artist found the path to her fun and creative business endeavor. Continue reading →. Exceptional Entrepreneur Series: A Multifaceted Entrepreneur Living Her Dream. Live Simply, Live Thrifty, Live Savvy.
Live Simply, Live Thrifty, Live Savvy | Life Lived Better | Page 2
http://livesimplylivethriftylivesavvy.com/page/2
Live Simply, Live Thrifty, Live Savvy. About ‘Live Simply, Live Thrifty, Live Savvy’. Awards & Accolades. Let’s Get in Touch! Newer posts →. 70 Things I Love about My Work at Home (WAHM) Life Part 5/7. I’m back with another installment of my blog series that covers what I love about being a Work At Home Mom. Are you impressed with all the many reasons I’ve provided so far? If you’ve missed the first 4 parts in this series, you can get caught up here. Now let’s get moving on to our next 10 on the list.
Guest Post | Live Simply, Live Thrifty, Live Savvy
http://livesimplylivethriftylivesavvy.com/tag/guest-post
Live Simply, Live Thrifty, Live Savvy. About ‘Live Simply, Live Thrifty, Live Savvy’. Awards & Accolades. Let’s Get in Touch! Tag Archives: Guest Post. Saving Money: Travel Edition. Love to travel, but hate the expense? Check out this guest blog post filled with helpful tips to trim travel costs. Continue reading →. Having a Pet Can Be Expensive Here Are Some Cheats! We love pets, but they can get expensive. Find out how guest blogger Roxana Oliver cuts costs on caring for her 3 pets. Pay Day Loans (1).
Come Follow Us! | Live Simply, Live Thrifty, Live Savvy
http://livesimplylivethriftylivesavvy.com/come-follow-us
Live Simply, Live Thrifty, Live Savvy. About ‘Live Simply, Live Thrifty, Live Savvy’. Awards & Accolades. Let’s Get in Touch! There are plenty of user-friendly ways for you to stay connected to this blog. Click on the button below to be taken to our page on the indicated website. Thank you to all of the individuals, as well as other bloggers and pages, who follow this site. Your interest and support means a lot to me! 08/22/2014 at 1:29 AM. Our all product are of high quality and of unique design. All Na...
TOTAL PAGES IN THIS WEBSITE
20
Feeling Blue, Depressed or S.A.D.? Or Plain Confused? | THE CRAZY RAMBLER ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ My unique view on Bipolar Disorder, faith & life in Holland (NL).
https://thecrazyrambler.wordpress.com/2011/12/06/feeling-blue-depressed-or-s-a-d-or-plain-confused
THE CRAZY RAMBLER My unique view on Bipolar Disorder, faith and life in Holland (NL). What’s In A Name? Are You Affected or S.A.D? What to Do When S.A.D. or Depressed →. December 6, 2011 · 9:07 pm. Feeling Blue, Depressed or S.A.D? On top of that, the time change can seriously affect people who have a sensitive body clock. The inner sleep-wake cycle can become pretty disturbed. Honestly, I don’t understand why we haven’t cancelled this whole stupid Daylight Savings Time already! Insomnia, early morning w...
Pack a Picnic | Randi Rentz
http://randirentz.com/pack-a-picnic
Why Buy A Wig. Motivational Monday →. A picnic is the quintessential essence and Shining Moment. One of the reasons why I love picnics so much is because you can have them anywhere. I love nothing more than throwing a blanket down in a back yard for reading, talking and noshing. Picnics are so special because they allow us the rare opportunity to sit still for a few minutes (or hours! Are wonderful for picnics. When I have picnics away from home, I like to pack individual portions in reusable glass c...
About | Chasing Bargains
http://chasingbargains.com/blog/about
Couponing– HOW TO START! Couponing HOW TO tips. 8230;……. Have you ever gone to the store and stood behind someone that was using coupons and it seemed like a painful ordeal? I have. I thought there is no way that I would go to all that work for pennies, nickles or even a dollar….and then, I saved $5 on baby formula AND used a formula check to save ANOTHER $11 on it. WOW $16 and I didnt even try! I just bought a HUGE CAN for $1! NOW THAT is worth a fill at the gas station! So, please bookmark us and visit...
Anonymous was a Woman: "It's Lupus isn't it? I know it's Lupus"- George Costanza
http://alx8182.blogspot.com/2013/07/its-lupus-isnt-it-i-know-its-lupus.html
Anonymous was a Woman. A women who refuses to be defined. Wednesday, July 10, 2013. It's Lupus isn't it? I know it's Lupus"- George Costanza. So, I haven't written a blog since January I think. That's a long stretch. I guess life has left me with little. Http:/ www.lupusny.org. Yes But I have to get this off my chest. Do I feel sorry for myself? July 10, 2013 at 1:13 PM. So sorry to hear about both of these pieces of bad news. :(. Best of luck and I will be thinking of you. Delavan, WI, United States.
About | Jllopez1006's Blog
https://jllopez1006.wordpress.com/about
Look for me on Live Simply, Live Thrifty, Live Savvy. Please find me blogging at Live Simply, Live Thrifty, Live Savvy. Leave a Reply Cancel reply. Enter your comment here. Fill in your details below or click an icon to log in:. Address never made public). You are commenting using your WordPress.com account. ( Log Out. You are commenting using your Twitter account. ( Log Out. You are commenting using your Facebook account. ( Log Out. You are commenting using your Google account. ( Log Out.
Catch Me on Live Simply, Live Thrifty, Live Savvy! | Jllopez1006's Blog
https://jllopez1006.wordpress.com/2011/10/10/catch-me-on-live-simply-live-thrifty-live-savvy
Look for me on Live Simply, Live Thrifty, Live Savvy. Catch Me on Live Simply, Live Thrifty, Live Savvy! Make sure to catch me at Live Simply, Live Thrifty, Live Savvy. Posted on October 10, 2011 at 9:14 PM in Uncategorized. 124; RSS feed. 124; Trackback URL. Leave a Reply Cancel reply. Enter your comment here. Fill in your details below or click an icon to log in:. Address never made public). You are commenting using your WordPress.com account. ( Log Out. Notify me of new comments via email.
JLLopez1006 | Jllopez1006's Blog
https://jllopez1006.wordpress.com/author/jllopez1006
Look for me on Live Simply, Live Thrifty, Live Savvy. October 10, 2011. Catch Me on Live Simply, Live Thrifty, Live Savvy! Make sure to catch me at Live Simply, Live Thrifty, Live Savvy. Create a free website or blog at WordPress.com.
October | 2011 | Jllopez1006's Blog
https://jllopez1006.wordpress.com/2011/10
Look for me on Live Simply, Live Thrifty, Live Savvy. Archive for October, 2011. October 10, 2011. Catch Me on Live Simply, Live Thrifty, Live Savvy! Make sure to catch me at Live Simply, Live Thrifty, Live Savvy. Blog at WordPress.com.
TOTAL LINKS TO THIS WEBSITE
14
livesimplyintheworld.wordpress.com
Simply Green | Living Simply, Living Green & Saving Money
Living Simply, Living Green and Saving Money. Saving Money with Organic Foods. April 26, 2010. You CAN save money and eat healthy, earth conscious foods! It’s so simple I can’t believe I didn’t think of it before! Here is the secret:. Switch to a plant-based diet. That’s it…. Apparently, and I just learned this new word last week, a flexitarian is someone who eats mostly a plant-based diet but isn’t opposed (morally or otherwise) to eating meat on the occasion. 18 lb for fresh caught wild Salmon, $7....
Live Simply Health Journals
Documenting your child’s Wellness Checks is going to be easy when using this section of the journal. The basic information given during these checks can be quickly documented while at the visit with your child’s doctor. We’ve made certain to include height, weight and even a space to write their percentile for each so you can make sure your child is on track. South Phoenix Healthy Start - Phoenix, AZ. Moonbeams - The Shops at Gainy Ranch - Scottsdale, AZ. Write Ons Etc. - Phoenix, AZ. This would make an ...
live simply | live simply. that's it.
March 20, 2014 · 6:48 pm. Yep – I’m building these. Even though our garden is well fenced, we always have interlopers. Perhaps these…. Http:/ www.grit.com/farm-and-garden/building-garden-fence-boxes.aspx#axzz2wWvo24jZ. September 14, 2013 · 2:21 pm. A wee miss calculation. Anyway, I have no shortage of things to do today. And tomorrow we’re butchering meat birds (so long as the wasps aren’t posing a problem). It will be a very full weekend. September 14, 2013 · 1:56 am. It’s still Flannelberry Friday.
live simply and simply live
Monday, June 20, 2016. Olive Miriam Asay joined our family on February 2, 2016 at 1:05 pm. She weighed 7 lbs 10 oz and was 20 inches long. If that date sounds familiar that's because it is- Olive shares a birthday with big sister, Scarlett. What was I supposed to do for 4 hours? Created by kira lee. Saturday, December 27, 2014. Created by kira lee. Labels: chaotic family togetherness. Wednesday, August 20, 2014. Where the heart is. Created by kira lee. Labels: chaotic family togetherness. On the fourth o...
livesimplylivehealthy.com
Welcome to: livesimplylivehealthy.com. This Web page is parked for FREE, courtesy of GoDaddy.com. Search for domains similar to. Is this your domain? Let's turn it into a website! Would you like to buy this. THE domain at THE price. Visit GoDaddy.com for the best values on. Restrictions apply. See website for details.
livesimplylivethriftylivesavvy.com
Live Simply, Live Thrifty, Live Savvy | Life Lived Better
Live Simply, Live Thrifty, Live Savvy. About ‘Live Simply, Live Thrifty, Live Savvy’. Awards & Accolades. Let’s Get in Touch! 3 Health Benefits of Eating Soups. I’m very excited to announce that we have a guest blog post. However, eating soup on a regular basis doesn’t just protect you from a runny nose; there are various health benefits of this tasty meal. So, clear or thick, eating soups is beneficial for your well-being and we’ve taken it upon ourselves to note these 3 major health benefits of sou...
Live Simply Love
What I Brought Into Marriage. October 24, 2013. If you’re new here, you may want to subscribe to my RSS feed. Thanks for visiting! In ancient times (and even today in some parts of the world), a bride brought a dowry usually property belonging to her parents into a marriage. The intent of a dowry was to provide future support for the bride and her children […]. My Gift to the World. October 15, 2013. Writing, Feeling God’s Pleasure and the Unintended Sabbatical. August 30, 2013. September 19, 2012. Augus...
livesimplylovedeeply.wordpress.com
:: live simply :: love deeply ::
Live simply : love deeply :. Take a walk with me. Vulnerability and enemy love. January 24, 2014. I hear echoes of the tune’s melody, and I wonder what act of love, as simple as a few notes played on a trumpet, might lift me out of anger, out of hatred, and into the fullness and grace of love.”. 8212; Mariah Heglson (Commentary on the video above). September 8, 2013. So, i’m here in Vancouver with the Servants team. Orientation is starting tomorrow. In this shared language i don’t have to have a th...
Live Simply Love Generously | Live Simply Love Generously Devotional
Live Simply Love Generously. October 22, 2012 · 4:49 am. Overview of Week 4: Life. As we continue reading through Gordon MacDonald’s book, Generosity: moving toward life that is truly life, I wanted to provide an overview of what you will learn in Week 4. 8220;See also that you excel in the grace of giving” – 2 Corinthians 8:7. God says that everyone should excel in the grace of giving. Whether poor or rich, young or old…giving is for everyone. But how often do we celebrate those who do? Excellent planni...
livesimplylovepurely.wordpress.com
slow down. live simply. love purely. | this is my blog. sometimes i write things on it.
Slow down. live simply. love purely. This is my blog. sometimes i write things on it. November 15, 2015. November 15, 2015. 8220;You’re so tiny! I’ve heard this all my life. I heard it twice today. And I will hear it until my tiny bones are laid in a tiny casket in a tiny grave. I’ve always hated being called tiny. In my mind, “tiny” is synonymous with “weak,” and though I’ve been told over and over that this is not true, my brain can’t shake it. You’re tiny. You’re weak. I am small, but I am strong.
livesimplylovestrongly.blogspot.com
Live Simply, Love Strongly
Live Simply, Love Strongly. Saturday, June 25, 2011. Live Simply Love Strongly. Tuesday, June 21, 2011. Whole wheat pasta, eggplant and green beans chopped small in my Vitamix, garlic, salt, and fresh basil, oregano and thyme. I told Chili this was Monster food, and that monsters like it because it has lots of vitamins to make them strong and healthy ;) She ate it all! Check out more Traditional Tuesdays recipes here. Live Simply Love Strongly. Wednesday, June 15, 2011. Live Simply Love Strongly. See mor...
SOCIAL ENGAGEMENT