livesimplylovedeeply.wordpress.com
:: live simply :: love deeply ::(by satiricalsymphony)
http://livesimplylovedeeply.wordpress.com/
(by satiricalsymphony)
http://livesimplylovedeeply.wordpress.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Tuesday
LOAD TIME
4.2 seconds
16x16
32x32
PAGES IN
THIS WEBSITE
19
SSL
EXTERNAL LINKS
62
SITE IP
192.0.78.13
LOAD TIME
4.219 sec
SCORE
6.2
:: live simply :: love deeply :: | livesimplylovedeeply.wordpress.com Reviews
https://livesimplylovedeeply.wordpress.com
(by satiricalsymphony)
livesimplylovedeeply.wordpress.com
January | 2014 | :: live simply :: love deeply ::
https://livesimplylovedeeply.wordpress.com/2014/01
Live simply : love deeply :. Take a walk with me. Vulnerability and enemy love. January 24, 2014. I hear echoes of the tune’s melody, and I wonder what act of love, as simple as a few notes played on a trumpet, might lift me out of anger, out of hatred, and into the fullness and grace of love.”. 8212; Mariah Heglson (Commentary on the video above). You are currently browsing the : live simply : love deeply :. Blog archives for January, 2014. Vulnerability and enemy love. Sol i dar i ty.
downward mobility | :: live simply :: love deeply ::
https://livesimplylovedeeply.wordpress.com/2013/07/30/downward-mobility
Live simply : love deeply :. Take a walk with me. I’m so grateful for this quote today. It resonates so deeply within my heart. That reading it feels like coming home . 8220;The compassionate life is the life of downward mobility! In a society in which upward mobility is the norm, downward mobility is not only discouraged but even considered unwise, unhealthy, or downright stupid. Who will freely choose a low-paying job when a high-paying job is being offered? By Henri Nouwen (pp. 138-139). This entry wa...
:: live simply :: love deeply ::
https://livesimplylovedeeply.wordpress.com/2013/07/09/1335
Live simply : love deeply :. Take a walk with me. 8220;To be a witness does not consist. In engaging in propaganda,. Nor even in stirring people up,. But in being a living mystery. It means to live in such a way that. One’s life would not make sense. If God did not exist. This entry was posted on Tuesday, July 9th, 2013 at 5:33 pm and is filed under Uncategorized. You can follow any responses to this entry through the RSS 2.0. Feed You can leave a response. From your own site. Laquo; Previous Post. Noun ...
July | 2013 | :: live simply :: love deeply ::
https://livesimplylovedeeply.wordpress.com/2013/07
Live simply : love deeply :. Take a walk with me. July 30, 2013. I’m so grateful for this quote today. It resonates so deeply within my heart. That reading it feels like coming home . 8220;The compassionate life is the life of downward mobility! In a society in which upward mobility is the norm, downward mobility is not only discouraged but even considered unwise, unhealthy, or downright stupid. Who will freely choose a low-paying job when a high-paying job is being offered? Dancing on my face. So, it...
:: live simply :: love deeply :: | Page 2
https://livesimplylovedeeply.wordpress.com/page/2
Live simply : love deeply :. Take a walk with me. Smoothies for the poor :. June 5, 2013. Satire causes us to reflect on often painful truths by disarming our defensiveness with humor. This is one of my favorite satirical videos that i stumbled on a few weeks ago…. How does this video make you feel? Does it make you rethink any things you’ve previously thought/believed? May 10, 2013. There’s a rhythm in my chest. All i am and hope to be. It’s the rhythm of that djembe. All i am and hope to be. Brought a ...
TOTAL PAGES IN THIS WEBSITE
19
Lovin' Life: December 2013
http://prinzis4.blogspot.com/2013_12_01_archive.html
It seems easier than sending individual pictures all over the place, and I can be as wordy (or not) as I want! Thursday, December 26, 2013. We're pretty excited about this gift from Santa :-) YUM! Subscribe to: Posts (Atom). A hundred years from now it will not matter what my bank account was, the sort of house I lived in, or the kind of car I drove. But the world may be different because I was important in the life of a child. Forest Witcraft. View my complete profile. All Kinds of Animals. Letter to My...
My Cottage Door: True change...
http://mycottagedoor.blogspot.com/2012/10/true-change.html
Monday, 15 October 2012. A treasure from a friend. Subscribe to: Post Comments (Atom). Today's Monday Maker is Robyn Stewart from Birdy and Clementine. Seeing with Resurrection Eyes…Part 5. Live simply : love deeply :. Vulnerability and enemy love. Urbana.org Least of These Blog.
My Cottage Door: May 2010
http://mycottagedoor.blogspot.com/2010_05_01_archive.html
Sunday, 30 May 2010. May God bless you with discomfort at easy answers, half truths, and superficial relationships, so that you may live deep within your heart. May God bless you with anger at injustice, oppression, and exploitation of people, so that you may work for justice, freedom and peace. May God bless you with tears to shed for those who suffer from pain, rejection, starvation, and war, so that you may reach out your hand to comfort them and to turn their pain into joy. Monday, 24 May 2010. Two n...
My Cottage Door: May 2012
http://mycottagedoor.blogspot.com/2012_05_01_archive.html
Saturday, 19 May 2012. Disclaimer: when I took these photos, I had no intention of using them in a blog. And now I am too lazy to take any more. So there is no 'Home Beautiful' treatment. Here is our kitchen. The first thing you see after coming up the stairs to our door. And here is our kitchen with cooking lesson in progress. The playroom at Easter. Easter - activities in process. A gorgeous kingfisher right outside our house. With nature a precious commodity here, I felt pretty blessed on this day.
My Cottage Door
http://mycottagedoor.blogspot.com/2012/05/last-week-we-were-very-lucky-to-have.html
Saturday, 19 May 2012. Disclaimer: when I took these photos, I had no intention of using them in a blog. And now I am too lazy to take any more. So there is no 'Home Beautiful' treatment. Here is our kitchen. The first thing you see after coming up the stairs to our door. And here is our kitchen with cooking lesson in progress. The playroom at Easter. Easter - activities in process. A gorgeous kingfisher right outside our house. With nature a precious commodity here, I felt pretty blessed on this day.
My Cottage Door: October 2012
http://mycottagedoor.blogspot.com/2012_10_01_archive.html
Monday, 15 October 2012. A treasure from a friend. Subscribe to: Posts (Atom). Today's Monday Maker is Robyn Stewart from Birdy and Clementine. Seeing with Resurrection Eyes…Part 5. Live simply : love deeply :. Vulnerability and enemy love. Urbana.org Least of These Blog.
My Cottage Door: Our First Jisu Christo Puja
http://mycottagedoor.blogspot.com/2011/05/our-first-jisu-christo-puja.html
Thursday, 5 May 2011. Our First Jisu Christo Puja. Being surrounded by many and varied pujas (expressions of Hindu worship – for a recent example see http:/ www.everyaffliction.blogspot.com/. Subscribe to: Post Comments (Atom). Our First Jisu Christo Puja. Today's Monday Maker is Robyn Stewart from Birdy and Clementine. Seeing with Resurrection Eyes…Part 5. Live simply : love deeply :. Vulnerability and enemy love. Urbana.org Least of These Blog.
Lovin' Life: June 2013
http://prinzis4.blogspot.com/2013_06_01_archive.html
It seems easier than sending individual pictures all over the place, and I can be as wordy (or not) as I want! Saturday, June 29, 2013. Mom, Gary, Greg, Joshua, Hannah, and I flew out to Minnesota together. The first night cousin Tam treated us to dinner and a show a Chanhassen Dinner Theatre. We saw "Joseph and The Amazing Technicolor Dreamcoat" and it was absolutely amazing! Sweet Chloe and Sue! Me, Tam, and Alexa :-). Impromptu concert number one! Saturday, June 1, 2013. Last Day of School! It's a lit...
Lovin' Life: White Chili
http://prinzis4.blogspot.com/2013/10/white-chili.html
It seems easier than sending individual pictures all over the place, and I can be as wordy (or not) as I want! Monday, October 28, 2013. The cooler weather always makes me want to throw something in the crock pot, and chili always makes the cut. Here's a new recipe we found in Taste of Home. And it was delicious! Thanks to The Foster Four for rounding out the meal with chopped salad and corn bread :-). 1 T olive oil. 3 medium onions, chopped. 2 garlic cloves, minced. 4 cups grilled chicken, cubed. Now fa...
WordMarrow: where's the f** in church?
http://amykopecky.blogspot.com/2010/04/wheres-f-in-church.html
Where's the f* in church? We've been in an odd season in our church recently. The words "disillusioning", "hopeful", "frustrating" and "confusing" also come to mind. I haven't been able to write about it, which is another oddity because I'm usually able to work through my thoughts better when I write them down. You may worship with them and pray with them, but. Do you hang out with them outside of church "meetings"? Do you go to them for advice? Do you eat together? We have both been in a few different c...
TOTAL LINKS TO THIS WEBSITE
62
live simply | live simply. that's it.
March 20, 2014 · 6:48 pm. Yep – I’m building these. Even though our garden is well fenced, we always have interlopers. Perhaps these…. Http:/ www.grit.com/farm-and-garden/building-garden-fence-boxes.aspx#axzz2wWvo24jZ. September 14, 2013 · 2:21 pm. A wee miss calculation. Anyway, I have no shortage of things to do today. And tomorrow we’re butchering meat birds (so long as the wasps aren’t posing a problem). It will be a very full weekend. September 14, 2013 · 1:56 am. It’s still Flannelberry Friday.
live simply and simply live
Monday, June 20, 2016. Olive Miriam Asay joined our family on February 2, 2016 at 1:05 pm. She weighed 7 lbs 10 oz and was 20 inches long. If that date sounds familiar that's because it is- Olive shares a birthday with big sister, Scarlett. What was I supposed to do for 4 hours? Created by kira lee. Saturday, December 27, 2014. Created by kira lee. Labels: chaotic family togetherness. Wednesday, August 20, 2014. Where the heart is. Created by kira lee. Labels: chaotic family togetherness. On the fourth o...
livesimplylivehealthy.com
Welcome to: livesimplylivehealthy.com. This Web page is parked for FREE, courtesy of GoDaddy.com. Search for domains similar to. Is this your domain? Let's turn it into a website! Would you like to buy this. THE domain at THE price. Visit GoDaddy.com for the best values on. Restrictions apply. See website for details.
livesimplylivethriftylivesavvy.com
Live Simply, Live Thrifty, Live Savvy | Life Lived Better
Live Simply, Live Thrifty, Live Savvy. About ‘Live Simply, Live Thrifty, Live Savvy’. Awards & Accolades. Let’s Get in Touch! 3 Health Benefits of Eating Soups. I’m very excited to announce that we have a guest blog post. However, eating soup on a regular basis doesn’t just protect you from a runny nose; there are various health benefits of this tasty meal. So, clear or thick, eating soups is beneficial for your well-being and we’ve taken it upon ourselves to note these 3 major health benefits of sou...
Live Simply Love
What I Brought Into Marriage. October 24, 2013. If you’re new here, you may want to subscribe to my RSS feed. Thanks for visiting! In ancient times (and even today in some parts of the world), a bride brought a dowry usually property belonging to her parents into a marriage. The intent of a dowry was to provide future support for the bride and her children […]. My Gift to the World. October 15, 2013. Writing, Feeling God’s Pleasure and the Unintended Sabbatical. August 30, 2013. September 19, 2012. Augus...
livesimplylovedeeply.wordpress.com
:: live simply :: love deeply ::
Live simply : love deeply :. Take a walk with me. Vulnerability and enemy love. January 24, 2014. I hear echoes of the tune’s melody, and I wonder what act of love, as simple as a few notes played on a trumpet, might lift me out of anger, out of hatred, and into the fullness and grace of love.”. 8212; Mariah Heglson (Commentary on the video above). September 8, 2013. So, i’m here in Vancouver with the Servants team. Orientation is starting tomorrow. In this shared language i don’t have to have a th...
Live Simply Love Generously | Live Simply Love Generously Devotional
Live Simply Love Generously. October 22, 2012 · 4:49 am. Overview of Week 4: Life. As we continue reading through Gordon MacDonald’s book, Generosity: moving toward life that is truly life, I wanted to provide an overview of what you will learn in Week 4. 8220;See also that you excel in the grace of giving” – 2 Corinthians 8:7. God says that everyone should excel in the grace of giving. Whether poor or rich, young or old…giving is for everyone. But how often do we celebrate those who do? Excellent planni...
livesimplylovepurely.wordpress.com
slow down. live simply. love purely. | this is my blog. sometimes i write things on it.
Slow down. live simply. love purely. This is my blog. sometimes i write things on it. November 15, 2015. November 15, 2015. 8220;You’re so tiny! I’ve heard this all my life. I heard it twice today. And I will hear it until my tiny bones are laid in a tiny casket in a tiny grave. I’ve always hated being called tiny. In my mind, “tiny” is synonymous with “weak,” and though I’ve been told over and over that this is not true, my brain can’t shake it. You’re tiny. You’re weak. I am small, but I am strong.
livesimplylovestrongly.blogspot.com
Live Simply, Love Strongly
Live Simply, Love Strongly. Saturday, June 25, 2011. Live Simply Love Strongly. Tuesday, June 21, 2011. Whole wheat pasta, eggplant and green beans chopped small in my Vitamix, garlic, salt, and fresh basil, oregano and thyme. I told Chili this was Monster food, and that monsters like it because it has lots of vitamins to make them strong and healthy ;) She ate it all! Check out more Traditional Tuesdays recipes here. Live Simply Love Strongly. Wednesday, June 15, 2011. Live Simply Love Strongly. See mor...
Live Simply Mommy
Monday, October 2, 2017. 5 Things: My Mind is on Food. After watching What the Health. My girls decided to go vegetarian. Of course, I had to follow suit as not to be tasked with making two meals per day. I have been experimenting with new vegetarian recipes, especially the recipes that can be frozen as I love to be able to make food ahead and save myself time and energy on week days. Two recipes are absolutely fantastic:. 1 White Bean Buffalo Soup. 2 Cheesy Broccoli Soup. Let the weekend begin! Beware: ...
livesimplymusic.com - Registered at Namecheap.com
This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! The Sponsored Listings displayed above are served automatically by a third party. Neither Parkingcrew nor the domain owner maintain any relationship with the advertisers.
SOCIAL ENGAGEMENT